SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN11923-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN11923-PA
Domain Number 1 Region: 792-1075
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.31e-76
Family Protein kinases, catalytic subunit 0.000000541
Further Details:      
 
Weak hits

Sequence:  DPGLEAN11923-PA
Domain Number - Region: 1156-1195
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0051
Family Pentapeptide repeats 0.024
Further Details:      
 
Domain Number - Region: 200-257
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 0.0772
Family C-terminal domain of adenylylcyclase associated protein 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN11923-PA
Sequence length 1253
Sequence
MSPVYSTVWEIGGARRATTQSSANTTRDSQLLSLLAARRRQLLAGRLTTHINTIASLAHK
PHKGNTTFAQLEIRDSNSSIVKRITFENSSNEAIAPSLKLVSREGNKEIRQDIKPHEIRH
LFIPRIYQDKNRAGFLNNRRKDFGNRSIVPKETTTENAVVYLPPEKLEGLDKEVDLDPEE
EFQVDESNHGLYLLNYSDTDNVTQGEVILNKTTSSNEIKDNSSFYIQTTTLLATDSIEKT
TIVPQFIQKEEKPEINSIANSTDLRNTNLVKIDNDTDKTNQTLFMSRELYNHFRPLETEL
NDEEMAPFIFFGQKLGSQGISDNLTNYPSLSASTKSVNFIAAPSNSEKRKFNSRYSATEK
YSNTSAGEEEINEEMDVSVAIKSNDTEANLQNVKSNTVDKNITIATPFYELTSNIDETVA
KDIAVVNKTYSAPPPRNFTRSYFNPRRRPPRPTLTSTEHVIQEEVNNATTEKASTSVYTA
VVTSVSITSSVKGLNKTDVSLNESSNVTADGSPEGLKNETTMSTANPINETETTTLPPIT
VRPYRHRYRIRTTTTEGVLKSKPTTLTLTQKPTSPTSNKDIETTSKISETLANLFRRNQY
ENSTNGITIPRNIAKRRRPTTTTTTTTTTTPIPAQTLNDKLIDVTETTALPTTFTTTRPI
EVTENTLKSIIIISETSSTSNSRPLTFTGNKSNKTVANNTMRLNNSLDESQNEEVVIEAE
KTYTASYVLAGLGFLPVIAVVAFVLRNLLNKKAKEIDTEYEGYFDEGGDVKKESPITPVA
RPPMPTPTKPDQKWEFPRNKLRLQTLLGQGNFGQVWKAEADDLNGHDGLTRLVAVKTIKE
SASQKEKQELLHEIYIMQKIGTHPNVVTLLACCTEQEPYLLIMEYVMCGKLLTYLRERRS
RPDRFSGSGALTSRDLTVFAYCVARGMDFIASKGIVHRDLAARNVLVDHNKLCKIADFGM
SRTAGASGRARGALPVRWMAPEALMYNVHTHQADVWSFGILLWEIVTLGSTPYAAMSGRE
VAAAVSEGYRLERPPHCAPPLYHAMHACWHADPSQRPSFGSLKATLAELLQNEPVEGNYV
DLDSFYQESSVYSDPSAIIHDDEGLSAEYDRERRCFRELQPGPAKFENRAFNLRNEELRN
KFGIGTPRMGGFGIRDMPFTERNFSDGEFNDRNFQDKNFQDRSFPDKNYNDANFSERKEK
LSTSSFHRERERENPLVSRNSFNGFPRIGTRDNHFQLAPDGRNKRVSEFECDI
Download sequence
Identical sequences DPGLEAN11923-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]