SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN13427-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN13427-PA
Domain Number 1 Region: 320-475
Classification Level Classification E-value
Superfamily Spectrin repeat 6.78e-24
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 21-158
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-22
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 665-772
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-18
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 4 Region: 234-335
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000288
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 5 Region: 162-269
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000082
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 6 Region: 571-669
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000691
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 514-600
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000302
Family Spectrin repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN13427-PA
Sequence length 774
Sequence
MSDTSSCMYNHRQFWFIKLNFNTQEIEERCRAVVEERGRLANSWAARQVALDQLIDWHCF
LRDAKQLHALCAAQEAALGSEISPTSSVEEVEHQLKKHEAFEKLLATQDEKLSTLNSHGD
KLLQQNHVESARIQEELAAVNDRRKKLYVAVGVRRGALLRARARAQFTRDAAEARSWVAD
KMAQLQLITGEVTDLEDKIKKLQRHQAFTAELAANRARLEEVGQLAKELEPDREVAKELE
QLEREWRTLEDAAEQRGRGLEEAQDILEFNQHLDKIEAWIRDKELMVQANETGRDYEHCT
ALLRKLDDLDSDMKVDDKHVKSVQALADKLLQQGPTQHAANVAARRDGVLLKWRALTGAL
QRYRERLAAALQLHSFNRDVQETSERLSRKAALFRSEECGRDLSAAHELRRRLDAAVREA
GTIRDRIHQLKNDGSALARSHPEQREIIESQLSQLDEGWEQLQKLAAARSDMLDDAVKEH
KFEENLKVSDVITSSAVVGTGVISDDLARLCVCACELEVWVTETVKRLDRAEPDSVTDAQ
AQLEHLHETKAEIDGRQKAISSLQKEAEQAQELEKVKRVEKLAAGLDQAWLQRKQYLTQA
HSLQVLKEQAQAVEDWLAGKEAFLHNDDLGDSLDAVETLIRKHGEFSKLLESQMGKVLEL
EKYAESISEGHYNRDYIMRRVAAVRARADQLKLSCVSRAERLQQALQLQQLLRDVTHARE
WIDLKMQIANDANYRELSNLQSKIQKHTAFESELAANKKRIDDVATAGEDLIGE
Download sequence
Identical sequences DPGLEAN13427-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]