SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN13428-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN13428-PA
Domain Number 1 Region: 299-439
Classification Level Classification E-value
Superfamily Spectrin repeat 1.66e-27
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 2 Region: 831-954
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-26
Family Pleckstrin-homology domain (PH domain) 0.00077
Further Details:      
 
Domain Number 3 Region: 97-231
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-23
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 4 Region: 26-128
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 5 Region: 391-533
Classification Level Classification E-value
Superfamily Spectrin repeat 2.73e-21
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 6 Region: 496-643
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-21
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 7 Region: 628-712
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000222
Family Spectrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN13428-PA
Sequence length 1194
Sequence
MAEYRDSGDSASKLRRSRLQEAYQARVYLRGLDDFTAWLDDVEAQLLSEDHGKDLSSVSA
LLKRHSRLEAAVGAKADTATQLADTARHLADNKHFMADEILEKADTAVKRYKQLQEPMSI
RRENLKDAELLHRWERDAHEEMAWLKEHEAAVWSEEAGGSLPEAQALLKKHQALGAELGA
REATISAVISRASALSRRGHFASAVLEQRSRELRAALRTITERAAHREAALRERCDLLQL
LSEIWEAEAWVAERRGAILGAELARDEDSALALARRLEALQRELQAFQPTIARIEKNYQD
RSYEDEQVRRKLDELKASYEEMNLLSAKRQQRLQQSLKYFKFVQECEEVQEWIGEQMTVA
ASEEYGLDVEHVDTLQQAFDYFMQQLHANEGRIEAVCEAGAALLEENTPEEERVKQKIED
IRGLWDDLKELALARQEALAGARQVHEFDRSAEETVAWVNEKEAALAALSSPAASQLHQL
KALRAELGAIRDQHQMLRDRASSLGEAFPDAKEHVLSKLEEVTEALEALEEKAAHSEHQL
ELADQLKAYFDKYQELMAWNNETLARVTAPELSSDVAGAARLLARHQDLAAEIHAKDESF
QTFYDDGEKLVREGHFMSQEVETRMSSLRARRAALDHAWSARNRIYEHHLDALMFLRDAD
ALDRWISSRVPLVRDGKYGESLAQTEELINRHRDLEETIDAQKEKFLALKRITLIEKAFK
DQKNEEEAARKQHLERQEAERMQLVRKREMERIAEERRRETEEQRGTAVQVERQLSSSGM
NSSLAGSVEETLSPAPQFDRLPKPDVHVKRAESMSVVKTPKRTPSFTTRRRTQSFRRHRK
HDDLPPVEIEGYLERKQEAGSGGVRAAVRSWRSYYAVLCGQLLCFFRDQEDFASSKAAAP
PVAILNARCTPASDYTKRSHVFRLSCADGAEYLFSCGSRDLLAEWVAKLAFHAALPPQLQ
LTPYNAEESPTADVRRRLQQNASSSSSAASSPEPQRHRTQAEILQEHRTSQKESQAGRED
NKSRVSADRHIESTVLPSLPPRQPPAVDDTADVVLSRGPAVAPRPARGQAPRGARQTPRA
AGERQGEGDQPGEQLPEDDEELPGEGRPELAGTVRGRLGLRRQQSTVISIWRVTSSGQQT
GFQVLGRIRAVSRREREERQEGSVRWTVQQEEEAAESHVEDRREDTDDTSIINI
Download sequence
Identical sequences DPGLEAN13428-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]