SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN13536-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN13536-PA
Domain Number 1 Region: 215-493
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.62e-63
Family WD40-repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 3-55
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000124
Family U-box 0.0014
Further Details:      
 
Weak hits

Sequence:  DPGLEAN13536-PA
Domain Number - Region: 61-120
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0623
Family Spectrin repeat 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN13536-PA
Sequence length 496
Sequence
MALYCAISNEVPEVPVVSPSSGSVFEKRIIEKYIIENGVDPISGKELRVEDLIEIKTPAI
VKPKPPSATSIPATLKSMQDEWDALMLHTFTQRQQLQTARQELSHALYQHDAACRVIARL
TKEVTAAREALATLKPQAGLAAPLGRSVEAAAAGAAAVGMSPEVVSRLQDRATALTQERK
RRGRTVPEGLVGPDTIRSFVTLASHPGLHSASVPGILALDINPSDHSRILTGGNDRNATV
FNKDTEQVVAILKGHTKKVTRVIYHPDEDTVITASPDHTIRVWNVPTSQTTVLLRSHEGP
VTGLSLHPTGDYVLSTSTDQHWAFSDIRTGQLLTKVSDASGVSLTTAQFHPDGLIFGTGT
ENSQVKIWDLKEQSNVANFPGHVGPVTSISFSENGYYLATAAEDACVKLWDLRKLKNFKS
IQLDEGYVIRELRFDQSGTYLGVAGSDVRVFLCRQWQELRVLADHTAAATGLRFGRDAAY
LASTSMDRTLKIYGLQ
Download sequence
Identical sequences A0A212FNU6
DPGLEAN13536-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]