SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN13687-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN13687-PA
Domain Number 1 Region: 147-345
Classification Level Classification E-value
Superfamily Hsp90 co-chaperone CDC37 1.44e-73
Family Hsp90 co-chaperone CDC37 0.000000256
Further Details:      
 
Weak hits

Sequence:  DPGLEAN13687-PA
Domain Number - Region: 34-107
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0059
Family Spectrin repeat 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN13687-PA
Sequence length 371
Sequence
MVDYSKWKDIEISDDEDETHPNIDTPSLFRWRHQARIERMEERKREIQEHEQRKTENIRK
LAETKRKIAEAESKGANLDSLKAELASIEKEQKEIQAKEDDLKKKEKKTPWNVDTISEPG
FTKTIINTKPNRPKDENLTEEEKEARMKKFIKENESLLKQFGMLRKFDDSKAFLQQHSQL
VCEETANYLVIWCINLEMEEKHDLMAHVAHQTICMQYILELSKQLDVDPRACVGSFFSRI
QVAEKTYKDSFDDELAQFKSRIQKRAAEKIQEAIKEQEEEERKARLGPGGLDPVEVYEEL
PDELKKCFDAQDVPMLQATIAKMPEQKAIYYIKRCVDAGLWVPGKNDEEPTMKANTSEQE
STPSVSTNDVD
Download sequence
Identical sequences A0A212FKC1
DPGLEAN13687-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]