SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN14883-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN14883-PA
Domain Number 1 Region: 115-276
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.05e-37
Family CRAL/TRIO domain 0.0001
Further Details:      
 
Domain Number 2 Region: 22-94
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000000562
Family CRAL/TRIO N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN14883-PA
Sequence length 299
Sequence
MPFIDIAFQAEVSRFEDQEFEECARRNCSEDPETRQTAIHNLRNLIYQRGECNPRRLDDA
YLLRFLRCRRFIPALAHKLIVRYEEFRRKNSYLYDCKAFGLQKVKGVYGGTLPESPHHGR
ITLMRFGRWDTEAVPVVDVVRCALLMDEIAVMQPKLQILGVTIIVDLEGLSVRHVRHLTP
TIAHQIVSLMGVSFPLLLHGLHIVRYNWILNTFFYVFKQFIPTAAWERVHFHGHDMASLH
RHIPPEYLPPEYGGCCPHVVEVDEWVRKVDRFKDDFMVNELRELGFTVDDQQYNKLYEI
Download sequence
Identical sequences A0A212F3L1
DPGLEAN14883-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]