SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN15490-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN15490-PA
Domain Number 1 Region: 99-278
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.85e-43
Family CRAL/TRIO domain 0.00019
Further Details:      
 
Domain Number 2 Region: 15-92
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 4.45e-16
Family CRAL/TRIO N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN15490-PA
Sequence length 310
Sequence
MASAATLVQPTGEMWKKIRVELNEDVNTRDNDLAAIKEWLRKQPHLPDSWDDGRTMTFLR
GCSFSLEKCKRKLDMYFTMRAACPEFFQDRDVSRPELANLVTKVQGAPLPGLTPNGRRVT
VCRGLDKNIDADELNNVFKVALMIGDVRLKEELEGVGGDIYILDASVVSPSHLAKLSPSA
IKKFLICVQEAYPVKLKEVHVVNTSPIIETLINFIKPFLKDKIKNRIFIHSDINTIYDHV
PRDMLPEEYGGNGGSLDEVNREWMKKLADYTQWFKEQESVKANEALRLGKPTNYDELFGI
DGSFRQLSID
Download sequence
Identical sequences A0A212FMF6
DPGLEAN15490-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]