SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN15535-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN15535-PA
Domain Number 1 Region: 119-269
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 6.28e-30
Family CRAL/TRIO domain 0.00043
Further Details:      
 
Domain Number 2 Region: 21-90
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000288
Family CRAL/TRIO N-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN15535-PA
Sequence length 310
Sequence
MHLKDQHPLYPCSESDKQEIRRELGMKESILQEDIDAILDWFNKQAHLVHAPIDRDHIEK
LLISTNGSREKTKRRIDNFYKYRSQAPELVLSRREVLTNPLYNGWSFYHQAAMFELYEKK
RISIFKITDPDPSKFDADVIFRNTIMLGDLRLKFDYMLGEIWIMDLENVSFGHILRVNPT
TIQKFMNIIQDGVGFKMFEIHFINVSSFGQHVVNFLKQFVKPKIMERFVCHENSENLHKY
IPKKYLPKDYGGEQPSLNDMKAILRKELLKDLSKNYLLECCQQLSDESKRMGTKYQEEHL
VGSFKKLEFD
Download sequence
Identical sequences A0A212FN21
DPGLEAN15535-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]