SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN16742-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  DPGLEAN16742-PA
Domain Number - Region: 151-205
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0105
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number - Region: 251-283
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0196
Family Rad50 coiled-coil Zn hook 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN16742-PA
Sequence length 310
Sequence
MRLKLDISKSTEKAPYIPLQQDEKSVLQQKIAELNKQKSQLLHHVFMVSCENKNLWSKLS
LLKNPERNAIERPRNPLVRTNTYIHSTPKCHNQYQEKYSDSSLEEISLKLINSYIQEKSQ
LVEQYEQMAQLQDIDDDILNVDSIGFTYIEDPAMDSLTEIRNHTDKLQQLKKELAQQEKD
LQLVLSRLETIVTNGYKCASCLKSQEKNTNFENKETETSNSLIMNKSLMNANSYDDSFNE
RKSPTKLNLEGNLDVNESFDRICPICGEKFKDDTMFSEFQTHVENHFIGENEVDSIDNYD
TIPNSLDNVI
Download sequence
Identical sequences DPGLEAN16742-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]