SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN16953-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  DPGLEAN16953-PA
Domain Number - Region: 15-63
Classification Level Classification E-value
Superfamily Spectrin repeat 0.011
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN16953-PA
Sequence length 74
Sequence
MSSVSVTSSKREKETVELSQELESVRALNSSLRAYLEHLQTFRKNLNAVNENTKILSKVN
SQWIETLNNMNNIN
Download sequence
Identical sequences A0A212ER52
DPGLEAN16953-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]