SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DPGLEAN17439-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN17439-PA
Domain Number 1 Region: 44-327
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.66e-101
Family Inorganic pyrophosphatase 0.0000000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN17439-PA
Sequence length 330
Sequence
MSVTRVLAASPRCLSFVKTLCASVGVVHVRKVTTVTETIRSKMFIAEERGSPFAPDYRVY
FKDESGPVSPLHDIPLWADRGRREAHMVVEVPRWSNAKMEISLGEPLNPIKQDVKKGALR
FVANVFPHHGYIWNYGALPQTWENPQHVDPATQARGDNDPIDVIEIGERVAARGDVITVK
ILGTLALIDEGETDWKLIAIDVKDPAAARMNDVADVETVFPGLLRATVEWFRLYKVPDGK
PVNQFAFDGEAKDAAFAHRVVDEVHEFWKALVAGEAADASDICKMNVSVANSAARVERGE
AARVLAGAPPAALPQDIPASVDKWHYLSSL
Download sequence
Identical sequences A0A212F0F5
DPGLEAN17439-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]