SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN18342-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN18342-PA
Domain Number 1 Region: 130-510
Classification Level Classification E-value
Superfamily ARM repeat 5.04e-167
Family B56-like 0.00000000000348
Further Details:      
 
Weak hits

Sequence:  DPGLEAN18342-PA
Domain Number - Region: 493-547
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0146
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN18342-PA
Sequence length 587
Sequence
MVHAGPAARAPSRAMFAAAETKPRRAVSPLGIPKSPSFHSGLDLVANQGAKRSESVSDVA
RAFRFALFGMEGQPPQKAPSPPDARSPPPPVVASVTVAVSPERPPVLNADKESLMVQLPL
LKDAPAGEREQLFVQKLRQCCLLFDFADEPLSDLKWKEVKRAALLEMVEYVTSQRGVITE
AIYPEAVNMFAINLFRTLPPSSNPNGAEFDPEEDEPTLEAAWPHLQLVYELFLRLLESPD
FQPNIAKKYMDQKFVLQLLELFDTEDPRERDFLKTTLHRIYGKFLVLRAYIRKQINNVFY
RFIYETEHHNGIAELLEILGSIINGFALPLKEEHKLFLLRVLLPLHKVKSLSVYHPQLAY
CVVQFLEKDPSLTQPVVRALLKYWPKTHSPKEVMFLNEMEEILDVIEPAEFQKVMDPLFR
QLAKCVSSPHFQVAERALYYWNNEYIMSLISDNTSHILPIMFPSLYRNTKSHWNKTIHGL
VYNALKLFMEMNQKLFDECTQQYKQEKQKERERLQQREELWQKLEARAATRAAQLNDTEP
RKQNYNASKPLLRKKSELPADVTTARALADHTRPAAFLTTPPDADGC
Download sequence
Identical sequences A0A212EZR8
DPGLEAN18342-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]