SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN18621-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN18621-PA
Domain Number 1 Region: 2876-3043
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.72e-29
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 3326-3501
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.99e-27
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 3 Region: 2663-2854
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-26
Family Laminin G-like module 0.0049
Further Details:      
 
Domain Number 4 Region: 3048-3218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-26
Family Laminin G-like module 0.0076
Further Details:      
 
Domain Number 5 Region: 3505-3676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-24
Family Laminin G-like module 0.00028
Further Details:      
 
Domain Number 6 Region: 1467-1517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000117
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 7 Region: 1804-1856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 484-532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 9 Region: 1912-1965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000809
Family Laminin-type module 0.0027
Further Details:      
 
Domain Number 10 Region: 1377-1425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1862-1914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.075
Further Details:      
 
Domain Number 12 Region: 530-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 13 Region: 626-673
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 14 Region: 726-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 15 Region: 264-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 16 Region: 581-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 17 Region: 1515-1563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 18 Region: 1965-2014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000257
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 19 Region: 779-818
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 20 Region: 324-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family Laminin-type module 0.057
Further Details:      
 
Domain Number 21 Region: 394-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000181
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 22 Region: 2012-2061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 23 Region: 439-479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  DPGLEAN18621-PA
Domain Number - Region: 671-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000173
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number - Region: 1430-1465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family Laminin-type module 0.035
Further Details:      
 
Domain Number - Region: 2059-2103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family Laminin-type module 0.013
Further Details:      
 
Domain Number - Region: 1769-1806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 2590-2661
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0633
Family Spectrin repeat 0.021
Further Details:      
 
Domain Number - Region: 2268-2432
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0915
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN18621-PA
Sequence length 3687
Sequence
MARVVALFLLYVSVACAEILKPPYFNLALGKRITATATCGDEGPELYCKLVGANADHDER
VIQGQVCDMCDGTNEVKKHPPEFAVDGMETWWQSPPLSRGMKYNEVNLTIDLGQEFHVAY
VFVRMGNSPRPGLWALEKSTDYGKTFKPWQYFSDSPQDCERYFGRESLQPITKDDSVICS
TEYSKIVPLEGGEIPISLLNYRPSANKYFNSSVLQEWTRATNVRLRLLRTKNLLGHLMSV
ARQDPTVTRRYFYSIKDISIGGRCMCNGHADTCDPAEPGSDTSILVCRCQHNTCGPQCAA
CCPGFEQKKWRISQNWDRFACEPCNCHNHTTECEYDAEIDEKHLSLDIHGLYEGGGVCKN
CQHNTEGINCNKCKPTFYRPYGKTWDELDVCQPCNCNLHYSTGNCEEETGRCECRSEFNP
PNCDSCAYGYFDYPNCKPCTCNLNGTEGQHCTPTDGMCPCKYNYAGKSCEMCADGYYSPE
CKNCECNSVGSVSQVCDKESGNCTCKSKYSGRTCNQCEAGYYEYPTCKQCNCDVSGTEPN
VCDDVTGQCVCKPGFGGVRCDQCLSGYFMEVKGRERSCVPCNCSPTGSTSTSCSADGKCN
CLVNFGGKQCDQCSPGYYKFPECLPCNCDESGTFGSTCDDSGQCHCKPNFDGIKCDKCKE
QFYNFPACEECNCDPRGVIASFAGCGSVPAGELCQCKDRVQGRICNDCKPLFWNLQEYNP
SGCQECSCNLAGTLGGLGACNTRSGQCTCKMNVGERQCDECQDGFYKLESQNLFGCAACD
CDIGGSIDNNCDKRTGQCRCHSRVEGRRCDRPIRAHYFPTLHQFQYEVEEGLTQSGPVRY
RNSEDVFPGYSWKGYVVFSLLQNEVINVVHIGKSSLFRMVLKYANPLRDPVTATIIVTPE
SVIDTKQGFNVQLRPTTQPQLVTVLVEKGIAPAPFVMNAGTWTVTIKTTKEVMIDYFVLI
PEAYYEATVLTKLVDKPCIIGEKKLCRHFAYPSLSGFPTANVSDMVSDVTDFINDPEQLQ
EHNAGPNDIPIINNEQNEIEYNIKIDPSGAYVIIIEYITPINRTALAASEINSDQGGMYD
LAPRGAVAIRFQSGDGPETIAFANLNDCPYTAPCRQVVVDDLSKISVFNVQEPNNVIYLD
GDTDTLAAIKSIIVIPESQWHLDYITPRPYCLRRNGRCSPAVFSTAVDSKKVEIESGTGG
DRERRPPILDNSTMVVYLVPQSDPVKIESKVPSPGDYIFVIHYYQPDNPESNININITTD
GQQRDATLPIEHCPSNSGCRAIIIQAGGNKQYAVNENFTITFQGNTSKGVWLDYVLVIAK
SDFIDSALKENNMVDYTREFIEKCALNHYHISSNETGFCHDAMFSITSEYNSGALSCFCD
FMGSTELECNTFGGQCPCKENVIGRTCSACKTGYYGFPNCRPCHCPSTAICDDNGECICP
KNVEGENCDRCKPYTFNFDVQRGCDDCNCNPMGVINDQLQCEADSGNCPCKDNIIGRTCD
HCEPGHYDFPDCVQCSCDLNGTTDDVCDQNTAQCYCKKHVKGQACDVCKEEYFNLQSDNP
EGCTKCYCFGKTTRCSSSHLSWAELNGMSDWYLANIEANRTLSIFRLGIDPTLFNDSVIS
ADLSGSEEDSQKVVYFGAPDYYLGKRLNSYGGYLTYSIFYTTRDDGRAIAAADVIIGGAN
GYIVHNSVEQPPSQMNWMHTVRISEDEFTNLDGTAVTRDQFMNVLVNVTSIYIRATYWNE
AVTTRLMGVTLDFGIEEYAELDKQAVSVEDCQCPKAYKGLSCEQCAEGHYRLTSGPHAGF
CVPCQCNGHSKECDVNTGICLECTDNTMGDHCEQCIPGYHGDATVGTPKDCLICACPMPY
PSNNFAVGCDLSGNGSLISCVCKPGYGGARCEFCAAGYYGVPEEIGDYCKPCNCSGNINT
DDPGSCDSITGDCLKCVNNTSGAACNLCAPGFFGDAVFSKNCTACVCDEYGMERCDPSTG
TCICRPGVIGSSCNLCKPDHWGLNSGQGCTPCDCGIASESSQCDDNNGKCKCAKGVTGMH
CDQCAAGYWNYSKDGCDRCNCNKGYSVGFMCNATGQCECLPGVVGEKCDRCPERWVLIPQ
EGCLECDSCTDALIFTVQNLTELLLNETLDFKDKADSFFTTQRLNYIANQTELLKPRVSE
LKNVELETVTSSVKTLETSAKNLLRSAEFAATDSDKQILRAADLANVANDILASVRKNSE
KAKKSVSHVSELATGLELSQQPKVDSAVTEARQIKNDIAEKDFKNKEVQAFNAYTNSTKQ
IERMNLFVQPVNEQVKKFESLLNDTRKLKKKLDDMLEYTDLAQHTATEAEKLNEINKKSK
FGNKVLSVTKLNGAAMKDLIDAAIDINNATFWTIKVGNIVQNASKVLEEVNNTNGNVKDS
LDMIADKLPELTNLTDEALNHARNLRNRADKLRALAEQENNNTRTQHAYSAASAYSSIVQ
EIQDAKRASEEAEEAVATVKNINNELNERVMPARDGSLALSDRALKALETVEQKLSPNLT
LAKIGLQNATSTLGYADDENNAIQLSLPSSPQTSLHDETEKAEKVAKTVKSTKGIMSSLG
SELEVSKEFAQTLPKLADDAQKMTSNIDNLLNKINQMDPTISSTYRTVKLKQENLESLRK
EADEKLQKLRELIEQARTVANRIQVGVTFDRWSTLQPRLPDTVDEMSTSTHVSAYFRTKE
KNGFILYLGNPKDTMLRRTKSDDFMVIGVQNGYPYLVMDIGETAESGREPARIGSEKFVA
DNRWYQVIVDRVGRNVKLSIRESLDSGSDKIHVKEAVLPGQHTIFNLDRDKSKLYVGGVP
SDAKLQGISFPAFEGQIEELMIGDTPVGLWNFVSSDNLKGARQRDKLISSQSGPQEYRFN
GRSHVTMPGRGYLSPQKNQVLLFFRTYAPDGLIYLVGEGKHFFSIQMQDGHVYLQVSLGN
TNDMVIIGTTKAYNDGKWHRLDAGRYFSSCSLRVDNEILKMVSTSAAKEIPSLDTMNFGG
NNKDIIQVTNKGFDGCIRQISIDGVNIDLSENVESVGIAYGCQFASLVSLSGENSYLRFV
DISTENLQLTLKFKTNEPSGLLFVYVSRTQTTSMPDSISLSLNKGKLVLMSQRESLDTGL
STYNDSQWHVVTVTHNDKALRLVVDDFDYFSTDSAPAPLHIINGVLFVGGVQPGYVVGGE
VGSKTPFKGCIADATFNGRVLNLLEPFSNHSVTFGRCGKITTTGGVPPDVSLWPTPTRDD
VLPTPVLNVPVDEKEPPTLVFSAEETTTAMAVPSTESLPPTTTTTMATIPSTTTARASTT
TRRPPPAPQPGCALAFDPQYEIGDPLEGYRFGTKEDSRIEYAKLPGRQLEGFDLTISFRT
FDQHGGLIFYAAAERVPTQFLALYMKDAKLHFTFNCGGETGLVTSSTTYNDTEWHTVTLV
RNNGHGKLTVNSERIGETSVSCYAPTVLAPPYYYGGLRNVTNTISQNLMDFYQPFKGCLK
GLMMNGQYVTNILDRVNALRCTDNVEQGVYFGPSNNNHSNYLKLLENFKVGYEISITMEI
KPRNSTGLILSVYGKKDFMILELLENEVIANVENGKGPFHASYKLGNKFSLCDGNWHRIH
AVKSRHVVSVGVDGHFSDAGLGQSGSTDTRSALYIGGHVRPISTLRGTSSKRGFTGCIRN
IVIKETPVHIPLSAARRDTHVGVCPSD
Download sequence
Identical sequences A0A212F9M0
DPGLEAN18621-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]