SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN19575-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN19575-PA
Domain Number 1 Region: 428-557,587-615
Classification Level Classification E-value
Superfamily Spectrin repeat 4.54e-22
Family Spectrin repeat 0.0075
Further Details:      
 
Weak hits

Sequence:  DPGLEAN19575-PA
Domain Number - Region: 166-238
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 0.01
Family Molybdenum cofactor-binding domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN19575-PA
Sequence length 649
Sequence
MRGVATAVGRRTPRATDASRHVTLPAPAMTEGAGRPRPAPPRKPDSLTLWPWDDPPPPAP
EPTKPPLPLADFGGFSPYTPPAPIQPERRPRRPQSAVTGRQAPPVPRRPHSLGAVDDDWL
GPGPGLVAPVPLRPAPHATLPRVLTMPSSRSDYQLQRPAIMTNGYGAVPPSTSRRLSLPG
VQNAPKLSATFHGLSGLMGPVPSLGTPGTPSTPAAVREAVRHLLQQPRNGFPIMDHKLSL
FIDILDAQERFSQRAAYIIRAMMVYFNSNDNDDVTGSQLPPSPRMLIGLRGDIESVISKW
RWRPEPADRNIEEWKLQRSPQGLRPRNSSGTWPGRPRSGAAWPLEKFVTEGLCHRCGGDY
SYKGALKVNVDSSEYTGYKYFYNKPGYRVRARSYEDARFIHINFLLLAAMRHFESDLQSE
IETHRDVYASLTGTGRRLLGSLSSQEDAVMLQRRLDEMNQRWHHLKAKSMAIRNRLESNA
EHWSALLLSLRELTEWVIRKDTELNALAPPRGDLNALIKQQDDHRAFRRQLEDKRPVVES
NLLSGRQYVANEPPLSDTSDTEPSRDSEGDSRGYRSAEEQARELARSIRREVAKLADKWN
SLVDRSDAWGRCLDDAVQESPVVIVRGETLSVNTIINTADPESADRCCR
Download sequence
Identical sequences DPGLEAN19575-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]