SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN19576-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN19576-PA
Domain Number 1 Region: 188-313
Classification Level Classification E-value
Superfamily EF-hand 1.53e-45
Family EF-hand modules in multidomain proteins 0.0000214
Further Details:      
 
Domain Number 2 Region: 427-513
Classification Level Classification E-value
Superfamily RING/U-box 3.18e-24
Family ZZ domain 0.008
Further Details:      
 
Domain Number 3 Region: 314-376
Classification Level Classification E-value
Superfamily EF-hand 1.66e-20
Family EF-hand modules in multidomain proteins 0.00021
Further Details:      
 
Domain Number 4 Region: 153-187
Classification Level Classification E-value
Superfamily WW domain 0.000000000949
Family WW domain 0.00075
Further Details:      
 
Domain Number 5 Region: 28-141
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000157
Family Spectrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  DPGLEAN19576-PA
Domain Number - Region: 623-712
Classification Level Classification E-value
Superfamily Prefoldin 0.00471
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN19576-PA
Sequence length 804
Sequence
MHLQSDVCDISYGDEKEISKKAEMLYYELIRALEEEERRVRTFTTSLDELSSRVQTAEAA
RASWRAPGDARDARAQLDAVSRARAQLPPLKRLADELRGQAQAMARDNIQLPEQLVTRLD
DLNTRVSALSAGGEERARQLAGVARDGGAGAAQGFLAGSVRPPWERAVTPANVPYYINHE
LETTHWDHPKMIELMNSLADLNEVRFSAYRTALKLRTVQKALCMHMLQLPAALEAFDSHG
LRAQNDRLIDIPDMITVLTSLYEVIAAENPSLVNVPLCLDLSINWLLNVYDSQRTGQIRV
LSFKVGLVLLCKGHLEEKYRYLFRLIADPSCRADQRKLGLLLHDCIQIPRQLGEVAAFGG
SNIEPSVRSCFEQASVRDNNKGTLDRKSIDKDKEKEKEKEKEEEERDAEGQLQHIEAFHF
LQWLQREPQSMVWLPVLQRLAAAEPARHQAKCNICKDYPIVGFRYRCLKCFNFDMCQKCF
FNGRKAKNHKLTHPMQEYCTATTSGEDVRDFTRALRNKFKSARYFKKHPRVGYLPVQTVL
EGDALESPAPSPQHGSSADDMHSRLELYASRLAQVELGARPADTPDSDEEHALIAQYCLS
LSGSEAPRSPEHVVSGIQREQRHELEAMIRELEEENASLQAEYERLKAKQTPGSTPEELT
GDNRNAPVDQDMMAEARLLRQHKGRLEARMHILEEHNRQLEAQLQRLRRLLDEPGCQSSP
GGQGSPGGRVSSGTLQTRSVTASQLATDSPAKLTNGLYQDTNDLGKAVEELVSVMTEDGH
QAPDVNLPPQYTNGKPEEKDKDNK
Download sequence
Identical sequences DPGLEAN19576-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]