SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN21126-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN21126-PA
Domain Number 1 Region: 54-281,310-355
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.45e-35
Family Glycerol-3-phosphate transporter 0.056
Further Details:      
 
Domain Number 2 Region: 383-462
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000876
Family Pentapeptide repeats 0.0081
Further Details:      
 
Weak hits

Sequence:  DPGLEAN21126-PA
Domain Number - Region: 498-612
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000562
Family Glycerol-3-phosphate transporter 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN21126-PA
Sequence length 613
Sequence
MTYTDTRLVSGTEGAGEPASTNMTHMPPENTEGNESGELLDYNDSSVLEQFHEDAIRQAG
CGLSQARVYLAVCLAIAGASLELASIAFVLPSAEIELCILPHEKNWLVLISIVGWSLGGV
GWGALAERGGRRRALHAALAVNAVFAAIAAFMPTYGTFMMARFCSALGSGGIIPTGFTYC
GELCPRQSRTLLLALLPASMGGGILLSAGLAKLVLPYNGHDALIENKEHFSAWHRYLLVC
TIPILASLVSLIWTPESPRYLLDVGRDVDAMMVYQNIQSGNRKRASDADYRLSELALPSK
RRPPALHHVRHGLKMFWQAFFQLFSSTYRNTTISLTGMLLFTVGIQFYLSAYVPSTVTKL
ENEAYELSKQSYENVSYEGVHYNETLENVSYEDVSFTNCTFRDMIMSHVSFVNCTFVNTA
LSNIKTSFVIFDNALFVNSTIIDTDMETGRELVSCTFNTTTVRGMTGSCPRHAELRWTQL
PRLRERTLGAHAVLAAAPPLAARAAHGYPAHAITCSVLLLLSPALFVSPHETTLYIIEAL
YGLLSTIIFFSVGVKILETYPSNLRCTAHGLILSVSYIAGAGMRGAPDLGPAFSSLLCAV
FAVCATVFAIRLK
Download sequence
Identical sequences DPGLEAN21126-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]