SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN22305-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN22305-PA
Domain Number 1 Region: 25-179
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 8.76e-30
Family CRAL/TRIO domain 0.002
Further Details:      
 
Domain Number 2 Region: 193-334
Classification Level Classification E-value
Superfamily PapD-like 6.17e-26
Family MSP-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN22305-PA
Sequence length 389
Sequence
MLYEIMVWRKKMNANEINENTVNLDYLKEGIFFPQGRDIDSCLLFIMKSKLYHKGQKNVD
EVKKIIIYWLERIEREEDGKKITLFFDMDGCGLNNMDIEIIMYMVTLLKNYYPNLINYII
IFQLPWMLSAGFKIVKGILPAEAIERLRTVNKDKLKELVAPEQALVSWGGKNEYVFNFFP
ENRISVDNTSKSSTLDSQHSLGEMLSLNPGKLLIFKVENDRICAQLTITNMDDSVISFKI
RTTAPEKYVVKPSSGILTSKASQTIQIQVNSGFQINSVEKDRFLVVSMQIPSADISAKEI
SEMWKTIGCKADEYRLKCSTVNMLKSEPIQEKPSHEHDSIMYKLNNLQNNHKMLVKNIKT
LRMYQYATLFLTFLSLSLCYVTYNKDCQL
Download sequence
Identical sequences DPGLEAN22305-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]