SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN01352-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN01352-PA
Domain Number 1 Region: 1112-1250
Classification Level Classification E-value
Superfamily Spectrin repeat 3.07e-24
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 326-463
Classification Level Classification E-value
Superfamily Spectrin repeat 3.22e-24
Family Spectrin repeat 0.00087
Further Details:      
 
Domain Number 3 Region: 62-178
Classification Level Classification E-value
Superfamily Spectrin repeat 1.38e-23
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 521-647
Classification Level Classification E-value
Superfamily Spectrin repeat 4.73e-23
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 786-934
Classification Level Classification E-value
Superfamily Spectrin repeat 9.32e-21
Family Spectrin repeat 0.00067
Further Details:      
 
Domain Number 6 Region: 900-1041
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-20
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 7 Region: 1045-1147
Classification Level Classification E-value
Superfamily Spectrin repeat 4.68e-18
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 8 Region: 208-298
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000433
Family SH3-domain 0.001
Further Details:      
 
Domain Number 9 Region: 643-751
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000137
Family Spectrin repeat 0.0029
Further Details:      
 
Weak hits

Sequence:  DPGLEAN01352-PA
Domain Number - Region: 1252-1289
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000964
Family Spectrin repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN01352-PA
Sequence length 1295
Sequence
MNLYQFLEDHEEEEGWVIEKQRICRAEVAAKDLRAVTALRQKHTALMHELRARDLVAQRH
RAKGQSLIESKHPKSGEIERRLASLAQQWEILRQLADDREKQLADAAEAHQFYGDANEAE
SWMREKRALVASSDCGRDVAGAAALLARQRVLHDELRAHGAELRALAAAADRLTKNGIHT
LQLPMEVESVAGEQEDEWSSESRLVPTEVWEEEPVERLEHRTVTEQRSVSQVKALYAFSG
QGISIAKGEVMFLISKTNPDWWSVRKADRTDGFVPANYVREIEPRVVPVQVRRPEKVRTV
QRVKKTVLVKQVVQVRRTPARRTRLPPPDRHPPVQQRMEHIQQEYEELLKLSEARRLQLE
DAIKLYSFFAECDDFDKWIRDKEKMLRTDEPQDSVDNAKRMYEKFVTDLSAASKRLESIE
AAAEELVAAEHGQAARAAARRQQLRQQWDRLLRLKQQKEKSLEGASSVELFNRTCDEALE
WMSEKERQLADGSASAADLRTVRALQRRHAQLERELQPLRDRLHTVTLLADSVKSQYPSE
RSNVEARQRQLCSSWERCEAQAAERRARLESAVGHQVFANGASQLQDWIQKIRSQVSSEV
RASDVATAESLLKDHQDVLDDIKAHKDEFKEVINLGQQLVATNPALTDVADTVKMLQQEQ
DAVMKEWQAKEQVLQQCLQLQSFNREADQIDAASGAHEAVLNYNDYGSSVDEAEAYLKRQ
EEVEARLSAQDERVAAFAARAHALIVAKPPHYAKEQLVLISSYHGSCAAPGPSLQGEELQ
QCLGLNQVIQSRCDSVVSRREAVRHAAAARRRALLANLAHHQVQYLMKNTDTQRTGPFLA
SVDELQTWIQDKTRTATDQSYRELANLERKLQKHEAFERELQANEKQLRNVESIGLSLQK
SDPGHAEEVSSRLQALQVAWAALVAASRDKGAKLRQASQQRIHRRSVEDAKARLAEVERA
LNSTELGSDLRSCKRLLLLHQALEQELSQCEQRAESLAAQGSDLVSSGHFDGAAIERDSA
ALLQAARALRPRAAERRQALETSLQLHKFAAEVSGELAWVSERQGAASSTTLPGDLHAAQ
AAQKKHAKLRAELEGRRPIVERVLHRGKELDTHPQAGKIKQLCKELEEAYSSVSSAAEER
AARLEAALKAQQFLHDAAEVDSWLADKAAALASADVGNDRHRATQLLTRHKAVELELDTY
AAIIAEMGHVAQSMASGGHPEGAALVTRHDQLAGSLARLQRLAASRQAALMESVCRHEYL
AESAELEEWVAEQQAAASSEDYGQDYEHLLVSNET
Download sequence
Identical sequences DPGLEAN01352-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]