SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN02983-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN02983-PA
Domain Number 1 Region: 93-181
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000275
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN02983-PA
Sequence length 191
Sequence
MRNESSYLHDNSLRSDWEQSMSDIATALQRRETHMLNHQYLGNNSTEIGTSPYCCEIINE
TKPLSIPCVHRTDAGCIALEGEKFEQSHGLPTQRVRTFTTSLDELSSRVQTAEAARASWR
APGDARDARAQLDAVSRARAQLPPLKRLADELRGQAQAMARDNIQLPEQLVTRLDDLNTR
WVVHHIYYHQF
Download sequence
Identical sequences DPGLEAN02983-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]