SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN04811-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN04811-PA
Domain Number 1 Region: 630-784
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-36
Family Spectrin repeat 0.0000976
Further Details:      
 
Domain Number 2 Region: 1343-1496
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-33
Family Spectrin repeat 0.00000783
Further Details:      
 
Domain Number 3 Region: 736-886
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-33
Family Spectrin repeat 0.00028
Further Details:      
 
Domain Number 4 Region: 106-255
Classification Level Classification E-value
Superfamily Spectrin repeat 3.48e-33
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 5 Region: 525-680
Classification Level Classification E-value
Superfamily Spectrin repeat 4.73e-33
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 6 Region: 1766-1920
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-30
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 7 Region: 1235-1371
Classification Level Classification E-value
Superfamily Spectrin repeat 5.96e-30
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 8 Region: 313-464
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-30
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 9 Region: 1447-1597
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-29
Family Spectrin repeat 0.00015
Further Details:      
 
Domain Number 10 Region: 16-144
Classification Level Classification E-value
Superfamily Spectrin repeat 4.39e-29
Family Spectrin repeat 0.000022
Further Details:      
 
Domain Number 11 Region: 1660-1780
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-28
Family Spectrin repeat 0.0000517
Further Details:      
 
Domain Number 12 Region: 1038-1177
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-25
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 1873-2027
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-24
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 14 Region: 2033-2147
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-24
Family Spectrin repeat 0.0002
Further Details:      
 
Domain Number 15 Region: 889-966,1034-1075
Classification Level Classification E-value
Superfamily Spectrin repeat 1.63e-21
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 16 Region: 966-1041
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-20
Family SH3-domain 0.0000637
Further Details:      
 
Domain Number 17 Region: 2255-2379
Classification Level Classification E-value
Superfamily EF-hand 1.29e-19
Family Calmodulin-like 0.007
Further Details:      
 
Domain Number 18 Region: 2149-2258
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-17
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN04811-PA
Sequence length 2416
Sequence
MEQIPPPKEVKILETAEDIQERREQVLNRYEDFKQEARAKREKLEDSRRFQYFKRDADEL
ESWIQEKLQAASDESYKDPTNLQAKIQKHQAFEAEVAAHSNAIVVLDNTGSEMISAGHFA
SETIRKRLDELHRLWELLLSRLAEKGMKLQQALVLVQFLRHCDEVMFWIHDKETFVCADE
FGSDLEHVEVLQRKFDEFQKDMAAQEYRVTEVNQLAERLVLEGHPERETIVKRKDELNEA
WQRLRQMALMRQERLFGAHEIQRFNRDADETIAWISEKDVVLGSDDHGRDLATVQTLQRK
HEGVERDLAALEDKVTTLDGEAARLAAIHADHAPAIHGKRDEIANAWQRLVQKAQERRTE
LESSYALHRFLADYRDLISWMSDIRALIAADDLAKDVPGAEALLERHQEHKGEMDAREDV
MNACASSGEALVAAGHRGSAEVRTALEALQRDREALNALWEQRRVLYLQCMDLQLFYRDT
EQADTWMHKQEAFLANEDVGDSLDSVEALLKKHEDFEKSLAAQEEKIKALDEFATKLIEG
QHYAADDVAQRREMLLERRAALLEKSSQRRALLEDAYKYQQFERDCDETKGWINEKLKFA
TDDNYLDPTNLNGKVQKHQNFEQELLANKPRVDEINALGSKLLEQEHFAKPQIESRMEEL
GGLWERLVQASELKGSKLQEAAAQQQFNRAAEDIELWLSEVEGQLLSEDYGKDLTSVQNL
QKKHALLEADVSSHAERIEALREQAEQFIEKGHFDADNIKAKRDALVARYAALDKPMAVR
KRRLLDSLQAQQLFRDLDDEAAWIREKEPIIASTNRGRDLIGVQNLMKKQQAVMGEMAQH
EARVEAVRAAGAALRDAGHFAAADIAARLHSLTATWTQLQEKALQRKQDLEDSLQAQQYF
ADANEAESWMREKEPVANTQDYGKDEDSSEALLKKHEALLSDLEAFGNTIKALREQANSC
RQQESPIVDVSGKECVVALYDYAEKSPREVSMKRGDVLTLLNSNNKDWWKVEVNDRQGFV
PAAYVKKIDAGLSSSQQNLADSNSIAARQNQIEGQYDNLLALARERQNKLNETVKAYVLV
REAAELATWIKDKEMHAQVQDVGEDLEQVEVMQKKFDDFQNDLRANEVRLAEMNEIAVQL
MTVGQTEAALKIKTQMQELNSKWTSLQQLTSERAAQLGSAHEVQRFHRDVDETKDWIAEK
EAALSTDDLGRDLRSVQTLQRKHEGLERDLAALGDKIRQLDDTANRLMSTHGDSADATYS
KQREINEAWHQLQARANARKEKLLDSYDLQRFLSDYRDLMAWINSMMALVSSEELANDVT
GAEALLERHQEHRTEMDARAGTFQALELFGQQLLQGGHYASGDIQDKLNAMADARQELEK
AWVARRMKLDQNLELQLFYRDCEQAEAWMGAREAFLAPADVPDGGDNVEQLIKKHEDFDK
AINAHEEKIAQVQTLADQLIASDHYAADPIDKKRAQVLDRWRHLKEALIEKRSRLGDEQT
LQQFSRDADEMENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANAERIQSVLAM
GGNLVQRGQCSGSEDAVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTYIAAVKDLDF
WLGEVESLLTSEDSGKDLASVQNLMKKHQLVEADIQAHEDRISDMNAQADALVSSGQFDS
AGIGARRSAINERFEKVRGLAAHRRALLHEANTLHQFFRDIADEESWIKEKKLLVASDDY
GRDLTGVQNLLKKHKRLEAELASHEPAVQAVQKAGEKLKDVSNVGVAEIEQRLKALEQAW
DALQALAAERGVKLQQSLAYQQFLAKLDEEEAWISEKQQLVMASECGDSMAAVQGLLKKH
EALEAELAARGVRVRDLTTEGEALLAAGNLHADALAHRLHALQAKLEKLTSLAARRKAAL
VDNSAYLQLLWKADVVESWIADKETHVRSDEFGRDLSTVQTLLTKQDTFDAGLAAFEHEG
IQNITSLKEQLVAAGHEQSAAIVKRHADVIARWQRLLAAAAARKQRLLQLQDQFRQIEEL
YLTFAKKASAFNSWFENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAQSDFEALAA
LDAQIKSFNVGANPYTWFTMEALEETWRNLRKIIAERDVELTKEAQRQEENDKLRKEFAK
HANAFHQWLTETRTSMMEGTGSLEAQLAALRQRAGEVRARRADLRRLEELGAALEEHLIL
DNRYTEHSTVGLAQQWDQLDQLSMRMQHNLEQQIQARNHSGVSEDALKEFSMMFKHFDKE
RSGRLNHHEFKSCLRALGYDLPMVEEGQPDPEFEAILNVVDPNRDGQVSLQEYMAFMISK
ETENVHSSEEIENAFRAITAHQDRAYVTKDELYANLTKEMADYCVARMKPFVDPKSERPI
PNALDYIDFTRTLFQN
Download sequence
Identical sequences DPGLEAN04811-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]