SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN05993-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN05993-PA
Domain Number 1 Region: 693-759
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000155
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 
Domain Number 2 Region: 235-306
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000104
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 3 Region: 102-154
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Weak hits

Sequence:  DPGLEAN05993-PA
Domain Number - Region: 75-100
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0593
Family Eukaryotic type KH-domain (KH-domain type I) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN05993-PA
Sequence length 784
Sequence
MESANFLTVKSHLSEFKNCSDKDTLSEASESGTSNSVTSAEDLQKLAVILGLNSAEDVYQ
ERFRVDRRRLEAMLADPHVRIAGRPDDVKLAREKIMQLLDTRGGLTIKRVMEDTGCHIHF
PDSNRTSAQEKSNQVSIAGDMERVERARARVRALTPLVFCFELPIVAPSQPLPDINSPYV
QQIQEQYNVQVMLRNRPKLHANLLVVKGVQWEVRATMEATTLLMTYMCGPLASQTQVQMT
LEISPMHHSVVVGRGAEQLKVIMKGTGTQIMFPDADDPNIPALRKSCVTITGQIKDVYAA
RQQLVGSLPLVVIFDVSEEGARLEADTARLMCKHNVYISVRRKPKQGIASVVIKGIERCA
GDIYEARRELLGGKEPSITAEIPESYNIPSLTNTMPNFGAFNPFSPTHASAITNSPCSPY
NLQLNELASFGPMFGHNPPTPGGYPTPLSPVAMTPPVFPSGWMIPSPQPRPGQFHFPSIA
NAPVMYKNQSTWNPMSSTNEMIHPPHQHTHHPQHVLNASSAASSGYQSNFTGSSVSLDTQ
NISGGDGSNVVSPSVSPISKTHSPTPSTDNERSQHELANIISELPLSERRAVGCEKKTLE
NLTKMSPLSSLSPLTPLNDYRKMKAEANKAMRESVGSGYRVPNTRWSGYYFSHTSPGPIN
LKEENTTPEKSWNRSDLVRPNIVETAPSPPTKQCRYQQLYDLLRDIGLHKYIDLFKKHEL
DMSTFASLNEADLTEIGITAFGARRKMLLVIAELQKQTSSYKAGSSDRKLLSSPQYSALA
QDKW
Download sequence
Identical sequences DPGLEAN05993-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]