SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN07105-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN07105-PA
Domain Number 1 Region: 221-459
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.87e-78
Family Calponin-homology domain, CH-domain 0.0000135
Further Details:      
 
Domain Number 2 Region: 504-615
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000211
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 3 Region: 1096-1220
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000129
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 4 Region: 1225-1318
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000016
Family Spectrin repeat 0.0081
Further Details:      
 
Weak hits

Sequence:  DPGLEAN07105-PA
Domain Number - Region: 642-768
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000767
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number - Region: 809-924
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00234
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 1007-1140
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00432
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 122-147
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0942
Family Ribosomal protein L36 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN07105-PA
Sequence length 1331
Sequence
MGHARPPSELCLESNSVSRAEAWTRWKKQFQLFLKASGVDKEEAGVHASLLINLIGTEGF
TYARPSLFQTTPRKTVVLKNIYEYYGVKSKVTLERYTFNTRNQQQSRRCIGARWGGSIGT
GACRQCRRVRRRSRFELTCRGHSRYRQHLQPYLASQGRQPAATGPALVPYTSSPSSRGHC
AHGVDYPVISVQCYVVQNSSNFARVCKVNRPVKKLNGIGVHEENNNNITDDESDYEREDV
QKKTFAKWINSQLAKQGKPLVNDLFQDLRDGEVLLSLLEILTAQQFKRERGRMRVHHLNN
VNAALRALAAAGVRLVNISSGDIVDGNPKLILGLVWSIILHWQVHYHLKELMSELQQTNL
EKTLLAWCRNHTQDYAGVKVENFTSSWSDGLAFSALLHRFRPELFRYNDALGLSPSERLD
RVFTLAQDHLGIDRLLDPEDVNTTNPDKKSIMMYVMCLFQSLPQTPASHESCDLEHGDGD
EIGSPGDLGAEKFLLELSEQQWRVGGVLEEGARLLREAALARDEAAEVRLQLRLLARRWE
ALRGAAMTRQADLHRALMRTQHDHLQRFRRWLTATEDRMSRMEAVSAPAGAALEATRALH
ADLRQQQPLVDALADCVLVVDDEDDRHEHQDGSDRPDLPLTSSDNVAAMEDELRALGERW
SHACQWTLSRLQRLQRYVDLEHRADLLRDKVSTLENDLKQMEAYPAQEIGEVLERIRSLQ
RCGAELRVRRDELNELLRSLEEQDDDHTASQLADRADQCQDRLDALDLILRVQADRIREL
GFDVDVSSELGGEVGGAGGTDEHVSKKPRLEAERAGVDFQAGYRAFNNWAAETENALLMC
MEQLQTASGTEKATGEARTLLQRVTRESEERRADFSNVEEIQRRLAADQELAEEAKLHAQ
SIEEVKKRWEGIQKMLLDIRNTLNLLEDKDNVYKNIKAFESDLQDIHAWKDRMLKETATN
NQLIHLRNKIRTLKQLEIKLKELNAQSIILLTKAFSKTHKDEVEADTKRINEAFEELFLH
LCKKEVEIKIALNKKLSPIQTEDEYKAVQRKIQEMESQIISEHAIISTREEMAKKLEELK
NMRRQFDDLQASYDAVVKEKRDKFEKGSLEELNLRSSVENLVLRFDDSKTILEQKIDKLE
KGISLLERLEGEQNAVDSWLKGLHRFMDEHRDVPVGELQLLEELLDRSNKFLEEKSEYTA
RVEAIEEMKRTVLEDCEEVVAKTLKADTLRKRFDSLTEESLKTNEELRRALEKTEGLFRR
VDDLETWLGRLRDDMPREDECGIEDSAQLYQMKMRFQTLKERCDDKTDEFRNLNEDGRWP
SHGTVAVRLGS
Download sequence
Identical sequences DPGLEAN07105-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]