SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN07106-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN07106-PA
Domain Number 1 Region: 295-426
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000115
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 2 Region: 5-143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000202
Family Spectrin repeat 0.006
Further Details:      
 
Weak hits

Sequence:  DPGLEAN07106-PA
Domain Number - Region: 1117-1198
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00384
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN07106-PA
Sequence length 1207
Sequence
MLLNAGAPAVARRLTQLNARWTADTHAVYERYKVLAEAWLEAGELRAWLSAQAAWLDGLQ
RRLRPDTSRAARADAEDISDELYDLENYIANRDEARVSRIEAVARQLADAHIMPQWIRNE
TETLARRWDELRLQAAERSAELEAAAREAARCEVALDSLRQWLGTVRDGGHVPTSAEFAD
RRASLREVRTQEEAHRAAGRREAADRLRDQLELAERELVSLERRVSVSGAGPAAAAGRLP
GDLAARLRRATETLEDVQRASGGLALHTHDPDEVRTQLRACLRFYRTLSEIKSEVESIIK
TGRKTVEEGGAERQRALSAEIDALKELYNRLGAHVTEAKGRLEAALLAAREIQSDLASLG
VWLRSAKVAGRHKLELEMSRMAAIRDKLQANYEELARGCDPAHLAGLRAQLDDVNEQWER
LRRRADTGADPAEDRGEDPARGEDSVSIHSRTCCRRRRGRPFHLFPVVVEFLSLCFIFPL
CFVTTVYSRARSRFPPVDCVCRARHWSCAAASATEADGNVLVEYENVTDTIKRRLESPVN
SHETEKPEQKRSRIPLALKSPSPIKKEVQEGGARSRGSSMERRVRSPSGNRTDSTSTMSA
DSIEDTTSLAGTPPAGSAPATPSAIRKDSSTFNLLKDSDLFTQISKNKIVAKSPSSSEVM
ESQSCHVVEVKEHEIVKSTVGLTWPAEATTRDVLEDVETVETVVEFIPQTVDTVEIIEDT
EEDEEEGAEERDSAGHFGHEPRTFVVEVKTLEHRMRPTIGILKRRRDHREKGVKVVRMDE
DGPYAIPGEEREVMLATTGEGLDPGGQNGLMDDEVNEYHILDDRLKEIVDEEERDEGEAT
SEGIYTEVEEGQTRVREPLSSSTPVKKHEDNRAHVVGADHKGHKVEEHEQILKNQVGGVA
PDAAALISRGDSLVYRLHGTRPALARRLQEVVQDPLRARWSALRAEAEHRRREALRAEDD
LRELGARLEAVRRAGGGSAAAHDANRLRDLCRDLRDRRIAFPERAVADALAEYDAAREQR
RGSDDHRHNLEERSEVVTRCNLEREAVSRALGSLRGSPLGGGDYDDFPLQEDALNAREEE
VARALTTARGDERLELEQARASLSAHGQYVSHKLASLRKYSIRLDDALAWTQTIRDRITR
GDLSGLREAVRDKEVEIGEVLENYNNIERECHAAKHSVCQEIRDRVQRLREDWREIRQDE
AGGEIGE
Download sequence
Identical sequences DPGLEAN07106-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]