SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN08354-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN08354-PA
Domain Number 1 Region: 3-253
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.9e-71
Family Calponin-homology domain, CH-domain 0.0000402
Further Details:      
 
Domain Number 2 Region: 3054-3182
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 3 Region: 3483-3636
Classification Level Classification E-value
Superfamily Spectrin repeat 1.88e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 4 Region: 5644-5765
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-17
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 5 Region: 4131-4252
Classification Level Classification E-value
Superfamily Spectrin repeat 2.55e-16
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 6 Region: 1579-1714
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-16
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 7 Region: 6432-6588
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000195
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 8 Region: 2634-2774
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000486
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 9 Region: 4562-4686
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000152
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 10 Region: 5005-5159
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000155
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 11 Region: 3919-4040
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000263
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 12 Region: 5367-5487
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000419
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 13 Region: 6211-6369
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000158
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 14 Region: 2845-2959
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000167
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 15 Region: 2444-2573
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000406
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 16 Region: 1021-1172
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000912
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 17 Region: 4780-4920
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000985
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 18 Region: 5220-5337
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000576
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 19 Region: 4290-4401
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000126
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 20 Region: 3269-3390
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000521
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 21 Region: 1498-1606
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000654
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 22 Region: 516-654
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000708
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 23 Region: 843-975
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000804
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 24 Region: 3758-3865
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000156
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 25 Region: 5801-5917
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000157
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 26 Region: 7080-7219
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000464
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 27 Region: 1131-1255
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000144
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 28 Region: 7372-7497
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000296
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 29 Region: 4904-5013
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000013
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 30 Region: 2967-3065
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000966
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 31 Region: 1683-1820
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000981
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 32 Region: 6743-6857
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000656
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 33 Region: 2103-2244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000698
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 34 Region: 1902-2030
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000102
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 35 Region: 5475-5588
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000605
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 36 Region: 6868-6947
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000733
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 37 Region: 3394-3495
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000081
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 38 Region: 6961-7104
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000104
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 39 Region: 4690-4774
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000108
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 40 Region: 1344-1496
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000111
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 41 Region: 4042-4144
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000336
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 42 Region: 1258-1361
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000353
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 43 Region: 2207-2354
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000518
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 44 Region: 6661-6756
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000576
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 45 Region: 659-750
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000633
Family Spectrin repeat 0.0046
Further Details:      
 
Weak hits

Sequence:  DPGLEAN08354-PA
Domain Number - Region: 6343-6429
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000111
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number - Region: 4455-4549
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000273
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number - Region: 7615-7720
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000979
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 6563-6655
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00388
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 735-842
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00755
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 365-457
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0187
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number - Region: 5906-5990
Classification Level Classification E-value
Superfamily Spectrin repeat 0.045
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 3186-3254
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0633
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN08354-PA
Sequence length 7723
Sequence
IYLLSDEQERVQKKTFVNWINSHLSKRIPPMRIDDLIYDLRDGTKLLALLEVLSGEKLPM
ERGRVLRRPHFLSNANTALRFLAGKRIKLVNINAADLVDGRPAVVLGLIWTIILYFQIEE
NSRALEYLSGSRCASAMSQESAPRAEERWKQGAKKTLLQWVANALPKDSNIQVSDFGPSW
RDGVAFLAIIDAIKANLINLAEMKRKTNRQRLEHAFDLAENELGIAKLLDAEDVDVDKPD
ERSIMTYVAQFLHKYPEPKTTGPDAVAAVQEEYELLRAWLTERVSVLTRHFETRTLSRNY
EDYVRAEADRRSREPGYLKLEKLMYAQSHVAIAPRSWRELVDLWIELERLHRRWLWMLDS
DLPGDFRNIGEWLAKAEYLLYFDELPTALDDRTAAIISEKLEEHSNFFADLPDVLDRFEA
ALRSPEASRIPAERLQDMKERLEIVHSRAPQRKSRLKYLEHKCCIVAFTELTKSKLATWT
GKYGRIENVRALLDDYDNFVTKNKIFQEFDRAYIDIKQVAEEYKKVCKVDRTEAREIDTF
LKEVAENWRRVASDVRCSRSVLEEVIAHWERWTSLSDQFTQWLDRAQHMLRVSEDERLEF
FQDLTVWKEKHQLLGDAAGFLAATCSDDITSEIKRKYVEITERWERIWEEAERYVRGGDV
LRHRRELAQGIQKLDVWLTAADNLLASKPRGTTDDIQTYINRLLQLNEEIEEHEELFKSI
SRTFQTAIADLPRDEVEANMSKLKQQKEALVFVRATVPVKLHQHRQLLVQHESLESGQKE
IGRWLDKAEDTLRSMETRREVIEECYEVHRSFFSRTTYYRSMLESKNKVFQNIVSSADTD
RSADVTDQIRLMKDLNDRFAQVSSDATRKEAELQRLVRAWEEFDEKARTVREWTSRAEAL
LADNRIDSKQAVDFHKRFFQEADERAVSELVRSGRELIELVSEPERPSVVETVEQLQRRW
RELLQAAPAHLMRLEFRLDEAVLQHTVKEIDKEIAYNQSDDADGILIRNEEYFRNQGKIM
QVEQCLQNLKKISQSYTQQTGDNSLEEELRKCEQMWEATVHRVEHFRQQLQRIPAKWDAY
REKFREMEMWMDHVDKTMDSIVREVDSAEAFEREKTIFQNICREADRKREDMKWLVQTLD
MLSNHCSDAEAQEEQLRLENLIARYKNLIPTIEITMIKTETYTRCYTYRREVHEVICILE
GAKEQARVEPDLQSLQHVEQLVLEQQAAVQKLDRQRPSVMSMLHRGKELIKDANAPAFVR
EDVRNLETGWNTAYETNTEKLHKLRDTQKVWSNYEYQKEDLLSDINKIESFVAHPGLELG
VSNINRELQETKSISTDLERAKGEKLPQLQQSYAELQSLTSNKPKPVIEKDLETIQRKLV
RVEEDVKTKVDHLEKFNEEWVKIENQLDHVRDWIKKESPLLISQIRSDNITPEERVEKSQ
TLQKVIAEKLETVRKVADQGTKLAVEHRVQDANRLKGDVVVLEKMMADLQRSMEHQTKVV
EHDLASWQKYQKGVSEIKPWIEEAEIKLGNVPKPASLPEAQQLQQQSRALITDCEKQLMN
LQILSSVSHQLSGKTSAPDEVDAIHSRWAVVHDLADQWNNKLDKLVTNWENFEKEAEKLE
SWIENGEKLINSRIINVETPQVEKLDRELNKLKSFGNEISQQQAKIISLSQTCDNICHSI
QPDGGTLLKNKVSDIKERTNALADTVRMKVNELSDKIIVKQEFLTKLHNFDNWITDFRRK
TESYDQISSDRVEPTLQSMHVLLQEHAAKAPEFTEIYNEVKNMTLASHPEETRSLSDTYS
NIAQHYQIIETNIQQNKAILKKWADLLNWHEDNKQQLTHIQYQTEGPKLTPESYEILRQE
LVNIIAKIPEWKSNVALLDGPSRIKVTDQSTGRIIPPSSLVKEIEMKAESLLNAVTTKRD
LVQKVGARWDKFNAQNQALSEVLHNVQSVLNEMSQQTVPLTEATIQDMTEKLDSVDSELK
EKQSIRKEFREEGLHLMREDQPNMGTIQNALSSADNNWDQVVNFVRDTKNKYILLSSTLQ
ELKNFTVAFDREMNRAEQLYNECMEAPNDYMQTAQSLDKAKKSYELLKRSKGLLDQMELI
KQSVLKQASTLGGFDTSPLEEAFLNSQTQWEKVNDGIIKRIQDLESQLIAWRQIDDTRNQ
VVTWLSETGQNLANACDNLEIRFGQNHLLKYKEELPIYLGLKNSIKTKCEQITNLNKSIP
LSQISSITDYLDSEFEALKNLSDNLEEAVSSLETKENKLKENIKRLSDSISKIRDDIIKC
DDMSGDNAKILDRLKKCQSCKVELQNLSDELDNLTQNVSEMNANYPGFYESLVPKELSTL
QKRFESVVIHANKTETTLLTFLQKLFTDKLNIFNRNLKILDDKTRWCMPDINSDKYNLEV
KSAALADVELGIADCNKKVVELKEACEILHVVAEPACFLEAAAQTEKAKKNLDVLSSNYE
EIKKRLQDNIEAWQDYEKHLENVSEWLRNKENRIRQDTANQLNLNDIQNKILETEDLNNE
IKKYGDEIKRLTEVGETVLSSNPDSRISQYINHLESRYQAVSKFMDQQLKRLNDLKNNKT
QYDKSILEFKNWIQDANSKIADVAAMSKHAKPTTSDLNQVKKMNDNKEIGQKLLNNAVES
GEALFSDVSPEDREQIRSELRSLRDAFEDSVDSLNNVIKDIETTLNKRSSFDDTFNQVQK
WISDKEIELGEFKLSPSLPEKKAQLHAYKILQQEVDLHQSMLSQLTEKLKLMPDEDSEKS
LKKIIDRYGAMSSELGNRISKYDGHVLDHEKYSQMFEEARDHLNHVIAENSLVAYAVVSQ
KDDVDSKIASLEKVTSRAQEIDNSLEELKLQLHSVLETTSPNGHPVLISEYEQLKTTWEQ
FSKQCKEYDKKLKDTLQQWNESQKALDDLDEWLKVKESQVRDQSLKSNLEAKVSHLQKVK
ELQSELESKKADFAALTDKQNVSSESNLISKTSKLATRYHSLNNLVNEIISKYEVFVSEH
EAFENEYNSIENWLLNMLSELQDLNEIVGDYAVLQEKQNKAKELYEMRNKKTPVFEEFLS
LGEKLYAHTSPDGREIIRQKIRKIRTLWDSFGDSFQETVNKLDQCLLQFSDFSLAQEQLT
KWLKDVEKAMQKHTELKASLEEKKAQLQNHKIMHQEIMTHQQLVESVCDKAQQLVDQTHD
ASLNVYLQSIKQLFQNIVTKSQNLQDNLEDCVKRHEELVRLIQQFKEWLGSQSEKLLDIE
NAIGEKPEIMRKLQSAVALKDIEKVGSSKLDEIRAMFSVVSKSTSETGNSVIKAEIDNLH
SQLLSAVGSISTAEQKLKNTLEVWNKFDASNELLSVWLKDMENKCRDQTLCSTLAEKESQ
LERYVKIRNDIHSKEKEIDAFVDESHSLVLLSGVDRLKPLVTQVSSRYQQLHLISKEIVN
HWQELVTDHKKYSQLRNEFDSWLKPLEDQLSQIITNEDKLSIESKGNKLQVFLLERENGE
HKMGILTAAGDKVLPETAANGRENIRSEIRDLRQRWDKLNDGILQQQKEYESQTLQWSSY
QDVLQQTLSWLDEKEKIVDSEEKVILNSAQDIKSKLLKNKTLLQEIYSHKRVIETVTEKA
KSIAASISSGKGENDEMAKITQSVWDRYNALTTRLSNIITKHEGAFDVYQQFADQQKSLQ
DYQKHLWDRLHLLSDYTGNKAALQGKAVKIQELLDAIPTGNNKLKILSDLIENNSVKLSP
RGKEGMSRELGLLRADLEKFTATVHDVKQAIGDKIQQWIEFDAANDRLQHWLSDTEMSLK
TYTPKATLEEKIDQLNKYQAILANLKKTENDVDKVTDEFSDLIENCNDTRITMNLQQLTS
RFQSVHSTAKELVKKCQQAVNDHNAYQDKYNQCIDWVKTAEHKFDDSQRNTSNTPEGIIA
KRESLNDLLSQRRNATLLVNNTFELGEKLYPSTSPEGKELIEQQLHDLQQTVDNLFDNIS
KAERDLDSELNKWSSFDENLKSVKEWLTLAEKNLPKEIELKATLDEKRNQLNVYRNYLQD
ALAHQQDVSDLETRAENLPDVNKNITKELNQLKQRHDIILARSKSFVEQYEAIVNNHQQY
SKAVMDLQEWVEATHNTCQLWGDINLERVSLSSNCEKLKSLQVSLPEEKNRIDKIRALGE
KVLPGTVASGQTNIRNQIDASHQEWEGLVSFINKTIETLENKIQLWNEYENMKDQCLAWI
RNTDNLIHAVDLKATLSEKQEQYNKFQELQGEVRAKELEIDNITEKAQNLYTGVLGPRGS
QLSDLTVKYQTLSQKVKDLTNRWHQYVKTHQEFTTNVAECSQWIEELRDKLDFCADLSSC
SQDDLETKLVLIQNLLLAKDEGFTKVQALVELAQNVMANTAPTGHEAINNSLVALQEQWS
ALLSRMIETKNLLDDSVTKWAGFLEQIQLIQKSNAWLEGMLAELTPYESSMSDKRAQLEK
LKEVEEKARCDRLEVDTLKAKAAEMLASGQQNQAASKAQETLNKFDHLYEKIKKLLADRE
EQYKDHRLYKEAHDELIQWLGRAREKVPSLKSKPLSDKLAIENSVAPLEALINKQAQGEL
LLEHLQHTGEVVLASTSPDGQSVIKNEMKALKESFDTLFNEIKQQKSQLEDTVNQWREYK
DEYERLSDWLQQKEILIKNHKLALLGTAKEKGGQVNEVKEIVDQLHKGKTDIDNFNASAT
GLLASHLDTYVNNQLRHLNSRYQVLINMANDVLKKVETNYEQHKNYDDNYEKTKKWINDA
WEITRSGSEAGNNSSKEALQKRLEQIEDLLKRREEGQNLVHATVNSGEKVLRNTRSDGKD
RINTELKELQNEWDRLVKKMTTAKVHLETALLQWADYSSSYSQLQQWISDREAKLQEVCE
QKVAKSKKGQDRHAGLTTGLSLGERKATLRQTNNIVQDIVSFEPMIQSVTSKASELMQQA
PASEITSKYESLSKQAKDLYEKQKETVEQHQVFIDAGTDFVQWIRAAKEKLGKCSDATGD
KESLSSKISQLKVLESELPEGQAKLQKALEQGEISCGLADEEDREDIEEEVALMQEEYDT
YVEQLHNTKALIEGGIVKWTEYEEQYKEALDWLSKTENLVQSFNKLQNNLEQKKVVLEEF
QCHLQTLFDWQAELDKLNMRAQTLLETCSDTRVSNGITQLTTKYNAILSLAKEVMKRLEL
HYQEHQQHNALYGECQDWLDRTREKLNQCAEIPNTLQEVNNKLNTVKLLRQSLEQGQNKL
RYLLELKEKVMMNTEQAGAAKIQEDTDNLKQEFDKLIADLQEVRNKLTTRASQFDDISKI
HKLLVEWLDDIDQKMQSDDSLLNDLSEKKAKLEKFKTFNRDIDSHKDLVNKLNEKIKEDA
SLKSKEIEDTLKRYDDIKKAVNDMINKLEEYVNSHIQYKESYDSFYDWIRNCKIEIQHCS
DSHGDKEEVQKKLKSVNKIIGSLPKGEALLQKAIKLSESVLETTGNEGKDNINQDIKQLK
IEWENLQQICKDTKKLLEKCLSAWSDFMETLEKMTKWVKDFESKLNTVQKADKITPEYLE
KCRELLSQALANKHVLEELNDRCENLMELSACAWVRDKTVNLQTEYTALLTKIQGLVSNG
EKNLSDHTEFIKAKEELQRWLETAHGTVHDSIGVGDIVATKDKLETVKLVSNRMTEGHHL
LVVLQEAFKKALNNTPPEEQDGLRNDVKVLQESWDQLKIDLNSITAQLKAAIGKWEDFEE
SKNKMNQWIEDTEQNLDRVPPASGELGEMKTLLEKYKHIEDEINNKSPEFERLKSEAAEL
SGWAKNPAAKKAVAALEKKCNALKAKCASKKADLEADIKDYNHYHQSLQDTEKWLLQISF
QLMAHNSLYISNREQTEEQLAQHAVLLDDVQKYQATLDDLEAKGRAQIERYEATTPSIRD
TVGKQLKNVNDSHKSLLATALQIERRLREGLAKFKEYEDTLESILNNLDECEPAITELDV
PVDGLAHGRDLLDKARALHNRLQTEKSRLCAAVAACSAAAASVSRPSSPADTAPPPVPQR
ELHVRARLEDLIDQTHVSDLGGARIDSLKRTLEAPEFSQKLVAFENKVQSHLETLRDAVS
GMEEAMKQVQEIQEWIAVHAALAHDWLSNPSKLRPEAAKQDMATMNDALASLAEKRNRLL
TEIPTEGLEDEINLEEELDKLEQTIHQAIEREKGNQSIIEDFRHKCQEIHDWFDSVLKKM
CLADKGSGLPCPQKLNALKELSSDFGQNGKDKVDAIKNVGNKVINIVSNLESQQVEEQMK
SVERRYNDIGKRIQRKLQMLEITYKAIDGTKSEVNAQNEWMQKEIDNILHPEPLSYDSKS
VKDRQKKAANLLKEADGKKTVIDSLEKKVSNIQSELEPSEQMQLESELSELSSKQKQLAS
LVKQEIERLGTCADTRKKLENDIEKAKNWLKSKVAEIKKLGGPVPLEVAKVEKDIAVHKK
LQSELSDFHNDTLSEVMRQGNAVSKDCSSENRAKLQALLEDLNKTYTAAKVDIDDKLAAL
NKLLQGRNEFEADVAKCQSWLNEAEVAATPELRTTSLQVLEEQLVKFEKLNKEAVEVEKN
IGKIKDKSKDIMDSLSDSNKLQLKEQVNVLSDRFARINAIINDKKNILLKHIKEYKDAAA
KIAAALEFLNEIQNKLKALNKPIGSKVEDVQPIIQAYEAILDDLKKNKAMLNELQGGNLH
DLQDIVSKQDELMSTIEDQISKLKQLLLLREQFFALVKEIEDFISKYTEFTAEIEKSNDS
LEEKIKRYDDIIVKIQGCEALLATATDKGQQIAAEGTVIDRNNITELLQSLKQQLLTLRR
NVEAKRQENERAAAEHKKLAADLSAILQSLHDNEAAVHSRPLLNRDVASVDKKLIEHATL
AKNIQGYLDKLTKIIDSIKSDDVVPGTLLEMISEGNSLKTSLPEELANREKHLQDNKKYR
QSYQQMVEKLSIWVNEANIRLGMGKNGTDFENIESDIEEHKTFFNSSEPEMKDLVGKKMQ
DIVNKIWPSLTPSEQEELSKEHQKNNQLLKNTLNSAKSRQAQLEIDLEIWKDFCQLVEKI
KAILDKNDIPEEPVTSMELLRLYVEKLKHAHNDLENQQALLDVVRERARELSVGADAASG
ERVEQRARELADRWEVACEGLAKRAATADSQLQRWSSLVDTHRALSAALTAAADRLRHLD
SSPPTRRRALDIKHELQELQSDVSSLEESKDDLVEHGDFVVSLLKPPAAAADIERDVKEL
VENYEKLRQTLAARLAEIDEIVSEFDRISEKIDKLRQQIEIYITKVRTFYVFGEDDEQGL
RQLSVEVSDLVESTKTFTEESRKRYGGSAPADIAQELSALELSAEALAAAMEEKEREWKR
AKTARTDYAADVDSVQAWVRAAELTARERTLPPQSYRERLVAVRSEEPGVADRVERLTRN
ARTLVEGSRDADDRSLIQSTVAALTEQFTAVCSELEARQAAVEDACDAVARFLALLEKVL
LWVETQRAFLARPLVLADLQEAQQKQTEYGNALKSCKQQAKNLADMTKELEAIERVTSPG
DLPSRLEAAENATVDVEKRLAKTNGLLQELAEEWERCEKKLKDVGHWLEATTRTLEAPQN
AKKPLRDRLAFREKLINDISTQKTKISYAVEKLNVHFGAEGVAAQSGAPSGVSSAARALA
GSLDALSAATGAQATQLAAALAQVEAYCADVARLRGSLLAAEQRLRHAAQPHFSPGDPEQ
AARAQQECREKVKSLQSKIQARNERIKLIVQRGGPDADPLSDA
Download sequence
Identical sequences DPGLEAN08354-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]