SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN08355-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN08355-PA
Domain Number 1 Region: 7510-7618
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000504
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 2 Region: 6977-7142
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000157
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 3 Region: 6766-6915
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000035
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 4 Region: 6657-6803
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000197
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 5 Region: 5623-5792
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000384
Family Spectrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  DPGLEAN08355-PA
Domain Number - Region: 6272-6368
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00959
Family Spectrin repeat 0.021
Further Details:      
 
Domain Number - Region: 6360-6499
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0345
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 7670-7738
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0863
Family Spectrin repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN08355-PA
Sequence length 7838
Sequence
MSILAYQEVERRIEELTWSIYELDPYYNEASDDEPAATLAMLVSSADRARASRRSRAVPP
PPARLVPAAPSPARLAPTTYAEIVKGSGSRSVSPPDRPMHRLPLMIQDREASPEEDNKVE
VHGLTRPCSLDDRAEFSEPKSSSDTECEMSACDTFPSGVNVYSREYSHDVCDYYENRDVE
CNEKVPEFNIVPQQPSIVEETPIITTTELRPSDCHDRSMSPASKHRSQELSYAEILALGL
SKQLKNSNVSLLPKPQVAQVEMVKEIVIEMEKSPSLQHEQKLKSKDSLKLKGVRPERPSQ
RSRSRDMPRQRRAPEKRSTKTNDAQMIKKKKTPKKVLEVQEFDDNPEVIDADNLPSQPTL
TLKHKTDKKSDCESSKMTVNKIETENEEPIHSENFEETIDASPEPSVAESVPKKSKKKNK
IKKTQGTVDEIERALKEIEESDKQKKKKHRDLLLMKSKKKKSQKHQVVTLAVENIREEEI
KFSNSKLKETPEIFLKDMTQNEQSLENITKSSGLKCVSPDLNISADLSDAVSGIEFGSIK
QKKKRKSKKQDKFQDKERSVDPTEEIKSLNVNTDLTKSKVIDDSDFKDMNISEKMQSEQI
LITEDNESMINKSEESSNKSKTYRKKSKTKKSRSTDTEETDKTIKEIEQNEIIKTTKDRE
TETVIESVVDISPSQVKIEDDSVSEIGKNKIITMDWNTLMEEEDKIPESAIEPITLDENE
MDISICSEQIASEVTILPEVTAVLSESEIVDCVKLSDGCEINTSSDQSEIENLSLNKTTA
SENEQNNNDKFYSDVVRKERFINVIEQTTTYRPIDDVETRTIYLITHEEKKMPPIRTVKI
FNSKNNSFEETSNEKKFPIESEKDENEEESFQSDKIDEEISGVDSINKIEVLKKSDSESH
VTEETLDNFKNTGIKIADVKDSYEGDKNVAVVMNIEKEDKNKETSTEIDSDDVFIEQAIF
GSVQNRRKPVEKSEVPEVVINEEIKPYMIGLDFEQLDYNYYQYIRNKTGSAIITSPQERQ
GDNDLSDEYKQNYITELEKQDYSNEEHVDTNSNSENIQENQASDNGQGKEFNSGIEDISE
IITPSIKETGDYALHGISPNKSGSLAFFEDMMPKYDYQNLQHAEYNLAIQATNKNALNLN
KLNNTDCIQNTVSEPFVEIEKKSTEVLPADNRSILTKSSEIKNETTDLLIFDSCTQLKYN
YQDIIDAEKRIIKENSIKPIQESKLILDESLNQAVNAEINSSENSINSDNNMKLQNAKSI
EVPRHQYQELLDAEHLYATIKSCQDRLESELPFKNNENEKSINYELSIDKKSIKHDSYIT
DADGSPERPQIIDTITDVTDDDISSKTNNCSQNEMKLIYEIPMYSYSELRDAENLLVTRL
EEKYQSKILKTVEDNYNYENILIETNIDSASCQNITKGVRESSERENLVFEVPGQNYKEL
QDAEYLYACQLSKNAAGIDNSDRSDVLLSKENERVPLENKDFNDDGVGGDFDLEEQKLPL
SVDIEIVENKPDCTYENAKQLENVSDKSKSHEDTILEVTIQENIKPEKTEIAYTIDLISH
ERSVLEENENIGYDIVGQIDNGTNNTTEVSVNTSKPEKGTFEENVSNFEADYVKQSLVPL
VFETPQSEKEKISTLDDTCLNLKEAEEEEFVIVDIVKDVSEEILNTSPVNSDSGSDNLLF
ANKTIAESVPETEEAVTENSKKQYDQKMTDSINLRTDEKLPDYRDNLPLTLDFEVDCEII
KSTLAFDKEEELIQAKHINESSVESTYSSRENICLQPKTTIESQPIDTQIRHNILSTDED
ISTLNLIESNLNKTNENLNIPPNIDCLNTDEENDIPRPEKSPIHSLHDLLPEIDSIPEFK
PAYTSSSVLYSKLSADAPEFKPSYMFTRDDNKDSESVTNIDMIQKKQDNTKSQKDEESTP
GPRNTLEPMTASYSSVLLNKAKELQDKSKTTSQSPEKKESVLKPSTAQEKEEHPDTKSKQ
KKRKKKDLDKRDSSLSLVSDTDNTLSNVKQNLETTNVWTKAAEEGKSYAEVVAEGLIGDE
PKDLRTHQHLDPPIVSDQEIIPILSDNSLQVVETKQENLKGVEESQTSWAKIVASNRPSP
ERMSKVNDPIVEITSSYKPPVILVDDSDSEIQRSDIHVDDDGFIKVDRNRRSRSRSRDNR
SQSPSTSKLIQKQLTPRDKSENRFEPLVSILKTEEESQGVESAIGRITTTKARKNRSSQP
KEEIKTKTPHIASNPPEEEKQQIKKDKKKKVTKLKDKPLKSNETPDQSESSLDRVMEDKV
EPTKKIEPQSQKKNKSKKKDKKTSRAIDETSTPLVPGMRTGQQGSLEQEKLVGHGTTKDL
TPVSTPEIMQTPIKDKPYSEAQFWKIDPSGIDELNNLSEILTIEVNKQEVPKLQLPVPET
NIDETLMEIKTDDEALCDVGEDIQSQISEEQSLENKMADLQREIEEMLLPENDHSLTSDD
IQIELSQTNISIEEQQDEIPDSISPILASPDPEDILLQTNDYCKENVDVSKSEHIAVSMV
DALLEESNSPPVMERASDYIPQHEVFEDLSLNATANTTEQNIVENRTNDNINLLKHTNNS
DIATNNMIYLKPENFRLEKFVTDDAEKRLAEQNDVVVTKDVNEKLEKNLMNDKLFWLEKH
LYHDAECQYFISLANQSKASANIQTELEIKDEDKDPDGGSGFSSNAENNISQNRFGSPCD
SNYISMDLPGGICSWKDQSSYLSVETPTDSLIRLVSDIPEDTLTPLSPAQVAPSPLPPPA
QEPTTAERIPKAAKDDLSNDIETLLEEVKIVQSNLSDLPDGSLDAMEEGLREGISILEKC
DEAAVLLEQKIMEFREEPEVKALLRELVSIRGRIAKLLVQARQGLNTIQDAKVQVAKQTK
ELEEQKEKVARLDRWLENINEELKESTQQADVLTDEDIVRYIEIYERYIREYEEYEVLLK
SVIVVIYDDSSHLKVKLDVTRKSLETTKDLVIKEIERLRQLLIQIRTAPEVAEDDISQTD
RTIDSTSMPEEIVSPREMNYVPERVVVEMSIPENKEFDGNDKQKTGTIIEDIPAQNVKSK
TISKETSELRQPKTHIQELLIQGESKPSATIETQTGKSLQSETPYLVDKSVSCAPEKKLT
HDVSITCIPQAEVEVQTSEPKDLEEILENIQVKQTTSDGHETIEIASRPVTREQKMDEQS
LFVDAHYQDDKEHKDSHLNIVHSLPQSFETVMVEPDETTTEVIVDADGTKRIIVKKVRKT
LVTRQQIIQGHQQESHLLSAENIPQHSFSQLTLEEEVGSKSFLRDDGGQRHMEYQLYDGK
VISGLPGSEVTIEEVTSRPDLAITMDQGIRPEEILQLAEGEIQPQIKTSSSVTAVVQQIT
KRIVKTRRRVIRRVVIIDGKEHVTEEIVDEPENVEIFEEKIPRVSINVKESETSHVFTVD
PDDKDKHQPEESPKSNEDSEHLPYERKSEKHESPFRESSEDNIFSQGDPTLETRTTSNIK
YPEGNEDIKRQLREIIQKESKECNVVLPGEQKPSKETSFTIPETVTQIVSADEQISNIPS
DIQSTETTSSATIIQQIIKTVKRKRRIIKHIQIIDGKEHVTEEIIEEPDDEEAVEGEPTI
TYTQNPEFSTKSIKIIRKVCVKDGKEYVTEQIVEEPEDDLSEATKVINIEKPEISDFKTI
EEQDFNRHTRLPRDQDVAEISKELLASEIHDSQSQIHHAIQNIKEQSQAFIEIEQIDNSP
QNDEKHDALSTDKTPVSGEISKINEQVVEYKSETPKTEVIKSQNTEERSLDIGLTEVLSS
NKEMLAQPDQDDSNDNIVTKITKKKTRVIRHIQIIDGKEHISEEVIQEPDEVHFVESDPN
DYPHVLQDEVVKTKNLKILRQVQIIDGKEHVTEKVIESPETTDFDYIQLHKPDVVDVPTQ
SITTNETILDKKSEGSIIIEEPLKDIEESNLTINEEFVNKLAPKDICDTPNIISSSKSVE
EKPERDLTQSFLEREIEHSNLYITPMESIEMDHDRNVLLKNQAETAEVKQENVIFDTEVS
KDMLPKEEMDLKNLNLPTESQTSELSNVVCEQSPTAFDSKSIKDRVSSQDPKPTVQNIIS
PKIDLLEFGRNNNASGVIQKVSTSDLLSDIQITDDKSVNIAVTELSKENYDTIIDSAKPT
DPTHLAKRNSESENEQIPIVHSNLNSELKDSTDIKEKPAHFKDEIVPVLEKAPKSYMTTH
QQTIETLDEPSSDLIKHKLIKTITKTKKRIIKHILIINGKEHVTEEIIEEPEEVEIVESD
PTSHAHVLQEQGIKTKTLKIIRQVQIIDGNEHVIEQVIEDPDDEYVPTTTVLADIEVQLK
QSQSTNVPTHISDVTQRLLEREIEHSNVLAAEPKDLKQPKELRAAEPKEKISIEQKQTSE
SQDMIQQQPQIATTELLDVPMTTEEQEIAREFLRSDEVDSHNLDLKNNATIQGELNKHIQ
VLSGEKLPPTFVEQELDTDKSIKQKLSEEHIEEHITVKNIEEPGYDTVVAATKALVTDVE
GAINKEAEKTFNLKQTSSYEESNFEDSFISKEKESLVSEQNIKNKSTDPELGEEIPSDQI
EVDSLKENTDTAEEIVKNTESSTDIGKNISLSLADQGKKEKNKSGIIEECYTSQSKTEVK
PASEGIVIIESDVNLQSEQPKISYIQQFETFKHEQNDENPENIELPKDIQMPAKEQVQKG
SDLKHETNMFIQTERLDTHMQALVGSSSSSEINNKTSKKDMPEKNYKCDFGSETENISQT
VDIAMSLVKTDDKQETEPKIEMELKIENFEKTLPCVVKKDINIDLPTRIHITEEKHENLQ
ENLKDIKEKSDKSKKDHKKRSKKKQKHPEEEASKVLDPEPFSETEKSIADTESSSLEHYV
QLSSPTLVESPKPSDSLLEMPKESEYPEENISVSMVSDHNTEKGYEPEDVSVSQEDKKMD
KQKKHKKRKAYAVSESTTYPHQTSTGDETAISTPVEMNEPIQQRVIKTKKGKKKISTEDK
QKEVKSEPVITPISPKVGSEIVTSSPRDESYHTLSETPEVNTVKILEECVGSSPEIVKRE
ISTTVTYPVNVVEEIATTEYSMQTSPEILDCEIEEKVDISKVEKTDFELQTSPTPVSEML
VQTVPIEDKEAHTQTLDNITIVEKIEVSDNQIQTSRSDTPEEIVKIEMTTQVVPRDIGSS
DNKFSQTSSPVVEQEIKFKETDNRDVQTSPEPQVQKDEKSTEIVIETLDSDIQTIKLDNV
DQETSTSPTELRNVNEISIQTPEVSVVHSSTQSELQKPEIGEGNIGDILDTKDKITTIDS
SQQTSPRKDDEQKQFDNMTKQEVERIDSTQQTSPRDDYSAPKPYSPVQDIREFVSVNVSQ
QTTPRDTFETQLPIKETIVKDNITVDSTQQTSPRFYSEDSISTSTDEPYEVHLRAQISVP
QIADDFLENERQSQISSQSILGDTQKQKKRKPKRKAESPLQSPGSLSDPINAELSMSVTP
SSEDLSSKDVSSIDEGISQIVSPIHPILHETNAASKPTYSDVVQRSKSKSPSPSKTVITK
PQKSEKEKLLETLEKRTQSINVSQKSDDSMTVALIEPSVEKSYDLVVNKELEEVVNAMNT
HDPSKVDKSVIIVIKTISIWLEEIQYRIKREIITGQTFSDDTERLKQLENFVKRLKETIC
ITEINEETITLIETLTRQISAVNTLSNQRPLRLDEEEKKWEKFLSEVERLKHSVDKVKSN
LDALIMSEATTQKKLEDLDDIENDNNDNVENVKKTFKLYRSLIESNPKLECPDVLYVCDD
NTKQVENTINTERDRLLQLTSLAEEYEQTLEDFGQITDVAEALLDGKIIVSNLDHLHEEI
QKHRKFFVNLSHCRAILESLENNLDNETRAKYSALHHSLHDRATTIIDRAAGRAQQMTLA
ASRWSTLDQGMKQEQQWLIVAQQRIPDLSNVTSIDHEQYINLYQSISLDVSHHYAKMLRL
MSITEGLQGLIICSGLECECSTALDTLFRLQEDIDSRLTRLTAFKETWITYDHLIDRIEG
WMNLAVKELEYITPENITTTNNLRRFWELKAHHEVHNTLKIESGIQFEKALEILPISDEM
VQRQFFSKIEDKWRDLSTKISSIHSTAIQTISDRDVPSSEKLTILEDEMRELAAMLDGLK
GVIKSEDELNLYIERLQVMTGRIDRIQNELGRLSLLPTADSESLSALLNQSSLLDDQISE
ELERSLLLKEKLVQVQAGIARCQKGQRRAQQILEECESAERLESDVVERASQTCDKLIED
LSTQWRDILALRQALHTLPTSLRVCMSPLSVERDISALQESHSSLESACNDLSARLRARV
ALWRRFERQLELLQGAVREADYMVELLTVQGQVDYDRLLKATEKLETLSDSLSQRNGELV
GALLEAARPLQAGVEDSVAARLTKDLDDATAAYHATCANLTQLCEKYNKAVDLWRRYRNA
AAGVRAVAERQEAALHALRPHDAPAAHRACLEQEARVAELRSLAARVAAETGSRALQADA
DALARRLQLVAGAVQALADLGEARQLARAKAQQAKEMFCDMKQDLTPLHEDGEIVEDKLI
ALRENLIALGKSEAHIAPAKAELPEIDREVSDEHSIVRILELWQAMFRDTFLHYHRLSTA
LVRSGDAATALRLWHEYLLDLQSFLSGTVPADYENLTEHRRLCRVHRNLLASQRSVLVNE
NRETKNKDLADKFDTLTNLHNETLARIVERHDEVCSRIAAWDDYRETNTELLRWLKEIER
EKEKLQLRYVHIKRIHKILAKIQNLSERLPEGRKLSEKLLGNLKKVLDFTEDTYAASVRM
EYAGIVKRVDNLQASLDTWRDFLTRILGLIGEYENLTGDLVKLYTKSQSEVMSYSDENPL
SRPQLLKAIEKYRDLRTKIDKTENQIEALSVIQEQLKECLSPQDMRIVNQKVWQLRQQRA
DLEHQLSIIIHRLQERVEVYTIFDSRLSRFEDWISTIESRLETTTLTGDIGALDPQDLIR
RINSDIQAETALKEREFEWLAETGTALIELSKKDEKSYSKNTSKHLRDVQERWHKLQETG
RSRIDKINELLETITQLEERLTELRLKLHTIEANLSASVVLEQLSTKAVDAKFQERDEIH
KNIEEESGEVGKTLNLCELVFNDPDVIKGNFDLRNLRTGVDIVEKKWKNICNMSEQRKKS
LKEIRKSAEIANSLLPKVEKKLDGIEKRIEKIEARKQRGEEQDESVAKAVIKDLDSLESD
LKKLEDAYSRIASARGVELRGAASDDAARLRTAVRRGQSLRSRILSADADAHGRFVAAHG
RAVVALAETDVRLTKALHLSPAPTDTQATLKELDGVEVDLRECEALVEEADRLAVVVSSM
SGVSDMVGEYRALCADVRARLLAARASVVSDVEAAVQTESLRWETDASLQVDTLTSKETY
RVELEAAVRETSDALEALRTALLVELKEYATREEQANAAKEIAKAGAKPEQTLELAKHLS
ELLLTECDATEEEAMLKEVESLSLRYEDLLPQAKKRELQIQEMRLPHSALYALTCEHESG
KLTCPQCTDRNWRQLDNDLWRLEQWLQFAEATEEARTDPPEAYEALEDVIQDHREFLLDL
DSHKSLVVWLNLVGSHVAGHARREADGAAVTARERLRLARWDSACRAAADWHARLQTALI
NNREFHDIGEMFIRLLLVCSGKNYKVHLDHRVMAAAERTVRAREPLRLTRPADQLRQDFQ
RFTELRDELARAEPRVLALRDAAQLLKDDGEDVCRRLSELRLRLKSLRKLSGVYALKLGA
ALARAPGGAPHTHVIMAAAASSSAQLLEEPEPALPLDDGVVPSSEHEAAALGGVRRGLRF
VLRVARASLPFQALLLLLLGAAALAPLIFVSKCRALFM
Download sequence
Identical sequences DPGLEAN08355-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]