SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN08391-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN08391-PA
Domain Number 1 Region: 21-81
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 0.000000101
Family Chemosensory protein Csp2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN08391-PA
Sequence length 92
Sequence
MKTFILIALGALAAADPIDYYITDNTGLDIEALAAQPLKMISYINCFLDRGPCCREYNEF
WKKYDPEHIYYDLLMKELEKYKPVSLPVLPIL
Download sequence
Identical sequences A0A212F0F3
DPGLEAN08391-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]