SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN08738-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN08738-PA
Domain Number 1 Region: 1242-1420
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.23e-48
Family DBL homology domain (DH-domain) 0.000000224
Further Details:      
 
Domain Number 2 Region: 1427-1545
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-28
Family Pleckstrin-homology domain (PH domain) 0.0000191
Further Details:      
 
Domain Number 3 Region: 842-982
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-21
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 4 Region: 247-392
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-17
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 5 Region: 497-645
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000262
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 6 Region: 1081-1195
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000153
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 7 Region: 714-824
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000158
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 8 Region: 19-161
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000183
Family CRAL/TRIO domain 0.019
Further Details:      
 
Weak hits

Sequence:  DPGLEAN08738-PA
Domain Number - Region: 165-289
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00615
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN08738-PA
Sequence length 1605
Sequence
MEVGARALDVLPLLQERVASLTGGRDRRGGPIIWFPANSRRDRVAPDDYRRLLHYLINIP
SDNLRSIGFTILIDMRGSAWAAIKPILKVLQEHFSSSVHQALVVKPDNFWQKQRTTIGAH
KYKFETTMISLEALPKVIDSSQLTPDLEGTLQYDHAQWIDLRLALEELMWQAGELLDRLD
DLQEDVARADFANDVSGARRAIDNHADINKRLAKMPVDELEAQGELVVQRLESAAAACTE
ASGAAVESTFHCGSPGALRAQLAAVRSAHQHAHKLWQHKKIQLDQCFQLRLFEQDCEKML
EWIVNHRTAFLSTYVEIGRSCAAAKRLQEEHARFAAACTGGGRPSVTRVTAAARRLADKR
HYAEPEITALAHRLERAYKQLSNGLEERSAVLSLSVVFHHKAEAYASAVGGWGAQCAVAL
QLATGGPGAPPCSDPRALEQHTQRHRQLYEHMCQAYTEVHSTSKKLLYQLDHLVQVCHQT
DPADMSEGSMSSAGGSGGDPAADYSSGANHVLAVIHQILGHHRALEARYHQARLKLHQRL
ALLLYKEDCRQVLDWLGNHGEKFLMKNTGIGRNLHKARMYQKSHEHFENVAQNTYTNAEK
LLSAAEELARSGECEAEEVLGVARELEAHVAAFAARVDRRRRRLDLAVLLYTHEKELIQW
LETLRGGGGGGVGGGTSDESPEAARRALEQCAQHRAASLEACAATIAHGEALLQDLRSSG
ETEAASTAAVESTLERLRGTRSALEELWSDRERRLELTLQLRHFERDALEVSSRLELWGE
ELQRTEPPRDPQQAEQALAAHNESVARMQHATFQVVQQGQELAAAIAEASDVMASSSDSS
EGAPMDAQARVQLLLEFLHDRQLDLEELAEERRARFEQCVQLGQFQKDAAQVVSWIRNGE
AMLSASFSIPGTLSEAEQLKREHDQFQVAVEKTHASAVQVKYRADALRAANHYDPHTIRE
ISEEVTERWQRLVTCAEERHKLVTASLNFYKTAEQVCSVLDSLEREYRRDEDWCGSTSAP
AAAASNLDKASQVAALIVKHGEQKEAFLKACTLARRTAETFLKYAARSAQVHGQTAAASK
AHHEQTRAILDTLLAQENKVLEHWTVRKKRLEQCQQFALFERSARAAVEWIRETQERCGA
AAAAAAGGVARESRERVRLLAQLADGLVEKGHPHAVQIKEWVAAVDARYAEFSGSMEGGE
SEAESDSGVAASLSSGQTSETETRVEQPPAASADDKRRSARRKEFIMAELLQTERAYVKD
LETCITCYLREMRTDPASVPTALQGKEELIFGNIEEIHRFHERVFLRELDKYETMPEDVG
HCFVTWAREFDMYVSYCRNKPDSNAAVVQHAGDYFDRVQRRKKLEHPLAAYLIKPVQRIT
KYQLLLKDLQACCAEGQGEIKDGLEVMLSVPKKANDAMHLSNLEGCDVPTDSLGEVVLQD
SFQVWDLRQIIKKCRERRVFLFDLHLLLAKEVKDTHGKAKYIYKTKFMTSELGVTEHIEG
DDCKFSVWTGREPMASDCRIVLKAPSLDVKQTWVRRLREVIQETYFSAALQQPPRSPARA
PPPSSQRSSRDFEDTDTENLDRNSLASFGSGNTTDSDKVSRINDQ
Download sequence
Identical sequences DPGLEAN08738-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]