SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN09489-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN09489-PA
Domain Number 1 Region: 85-223
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.4e-38
Family CRAL/TRIO domain 0.0013
Further Details:      
 
Domain Number 2 Region: 4-72
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000000249
Family CRAL/TRIO N-terminal domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN09489-PA
Sequence length 224
Sequence
MAEELKPVKDEDLKQLKERMQLIAEADPSQFHNDYSLKRYLRAFKTVDNAFQAILKSNKW
RVEYGVANLHENHELIEKYSNRARVLRHRDMIGRPIVYIPAKNHSSSDRSIDELTKFIVY
CLEDASKKCFEEVIDNLCIVFDLNNFTLSCMDYQVLKNLIWLLSRHYPERLGVCLIINAP
TFFSGCWAVIKGWLDENTAGKVTFVNSEMDLCQYLIPDILPTDM
Download sequence
Identical sequences A0A212ENW5
DPGLEAN09489-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]