SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN10888-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN10888-PA
Domain Number 1 Region: 198-305,336-457
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-61
Family Voltage-gated potassium channels 0.00058
Further Details:      
 
Domain Number 2 Region: 72-167
Classification Level Classification E-value
Superfamily POZ domain 2.59e-26
Family Tetramerization domain of potassium channels 0.00000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN10888-PA
Sequence length 668
Sequence
MNPMQKVIRIAEKCNLFEKLWKIQLARFSVEHPSRCRNCAVKKRSRAGRQGRPPQGGVVT
FEPIQHDHDFCERVVINVSGLKFETQLRTLNQFPETLLGDPARRIRYFDPLRNEYFFDRN
RPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGEQATNKFREDEGFIKEEEKPLP
SNERQRKIWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGT
KIEEDEVPDITDPFFLIETLCIIWFTFELIVRFLACPNKFNFFRDVMNIIDIIAIIPYFI
TLATVVAEEEDTLNLPRAPVSPQDKSTNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQIL
GRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGY
GDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQSQNFNHVTSC
PYLPGTLGEPYLSAIKNSSVSDDSSSELMELEDAALLADPQLENNIRRLREEERLLLEQQ
AAMEATGNTDDIAALEHQDLLRLNHLKQQELQRQLVILAQRQARANANANANANANASSS
LLAIEGPRDRSTEDTDRSERQRACRSDLNERSDRLERSDRGELRRRTCNVRVNALHVASC
AEALETDV
Download sequence
Identical sequences DPGLEAN10888-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]