SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN12707-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN12707-PA
Domain Number 1 Region: 182-281
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 7.85e-33
Family Chemosensory protein Csp2 0.0002
Further Details:      
 
Domain Number 2 Region: 56-153
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 2.35e-32
Family Chemosensory protein Csp2 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN12707-PA
Sequence length 283
Sequence
MYLALETSQLSKTKIVKSQSVFLKVTREFYIVACIGAFDFEALVALVAARPEDNYDRYEN
FDVDELVSNLRLLKSYAACFLGEGKCTAEGNDFKKWIPEAVQSNCGKCSDHQKHLVGKVI
KACIDKLPEEWNKLNAIHNPDGKYDEKLKDLPGKIRKLNKMKFLVILALVALAAARPEAN
YEKYENFDVDELVSNLRLLKSYVACFIGEGKCTPEGSDFKEWIPEAVQSNCGKCSDNQKH
LVGKVIKACMEKLPEEWKKLNALHNPDGKYDEGLKNFLDNYGH
Download sequence
Identical sequences DPGLEAN12707-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]