SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN13095-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN13095-PA
Domain Number 1 Region: 66-187
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000288
Family CRAL/TRIO domain 0.0079
Further Details:      
 
Domain Number 2 Region: 250-407
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000144
Family Spectrin repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  DPGLEAN13095-PA
Domain Number - Region: 184-257
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00446
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN13095-PA
Sequence length 495
Sequence
MKIRFEVPNKLEILFGRGQAECDGCGSDEEGRTVGELLLPQYALATGGLARDHRPLITFP
DNNNFHVVTASEYRRLLLYLTSVPSLLEAEMGFHIIIDRRKDRWNSVKAVLLRISEFFPG
IIHTVFVLRPASFLQKALSEVSSKLFKEEFRFRVIVCSSVEELYEHFDRSQLTPDLGGEL
QYSHAEWIQQRIALEKFSTLMKEISTKLDEFMHEIVDCDMGNDPTQTKELLDCQESRYKS
LKAELSSATSEGEELLSSMRTPHLTYNIISHVAAVERLIVQLDETEKQFDSFWEKHSMKL
NHWLKFRTFLLNFKQMQAALDGHLKTACDMTEVGETANRVQTLLQEAIEFEKQCNNDLDA
ASLVIDEGEVLMKDPLSSVDHIESKCEELRRTSSLLIEKIQKRNMLLTKAREVMDRIDKA
NDWCATGVEILAGEGGLIAVDKSLEDAKSFGLTSPEQFRDMLMQSATPETRALVTQVMYY
IRGLVKLNLSFETAK
Download sequence
Identical sequences DPGLEAN13095-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]