SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN14759-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN14759-PA
Domain Number 1 Region: 215-327
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.68e-32
Family Calponin-homology domain, CH-domain 0.0000249
Further Details:      
 
Domain Number 2 Region: 338-454
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-21
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 3 Region: 713-840
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-18
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 4 Region: 1197-1306,1359-1389
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000559
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 5 Region: 963-1112
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000103
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number 6 Region: 426-550
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000132
Family Spectrin repeat 0.0079
Further Details:      
 
Weak hits

Sequence:  DPGLEAN14759-PA
Domain Number - Region: 1085-1181
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0024
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN14759-PA
Sequence length 1416
Sequence
MSMYRFVKEGSSKRLFVQGTLESDESKPLKSSLKKPAPSPVGSPITTSLNLASVPRSLRD
SLTRNETVYDGNYPGMERTSYRSGSYREESYNGRIVHDGNQTHFEYDGDSALAVPLSAGG
RGLSELQEIHTNKRLSTEVLGSSLESTKISKKDDSGQRRITTRIVRKVTTLTRGEEKASV
EDVRGREVHRSAERYRHVEMESSLPRKVKISDIVVGQEPNMTAREALLSWARRSTAKYPG
VRVADFTSSWRDGLAFNALIHRNRPDLIDWRNIRSRQVRERLETAFHVVEKEYGVTRLLD
PEDVDTHEPDEKSLITYISSLYETFPEPPAVHPLFDAESQRRAAAYTELAAQHRAWLHEK
CSLMQDRAFPSTLIEMKKLLSESTRFRNEEVPLRQREKQKLFHQYRELEKYFESVGEIEI
EPTLRPEALEQSWARLLMAAQERERDLSDEIRRLERLQRLAEKLHRDIKQTEGGLDNVER
HIESEIRRVERGVHPAEAKQAAEQIEQELRTMEQDIQEMFQDAQALRDGRYPQATDLHRR
VQQLHERWVNARQSFTGRLVPRLSSVRLPVQQTTVRRETRTVLETRVHDADPKFQQLNDA
TRWCKEKLFHSKVEQYVYNRNNFSGDELNLYNQHLNQLQKLYAELLSTSTKRLSELDALQ
EFLQSATAELNWLSEKEQVELARDWADPHINLPAVQHYYEQLMSSLEKRELQFSNVIDRG
EALIAQHHPATKTIESHLQVMQSQWAWVLQLTLCLETHLKHTTHYHGFFEQIKEAEKWIQ
KREEALNTTFSQSEFTLDQGERLLKGMQDVREELNSQGAVVSRMVEEAQEVRPLKQRRAP
VTRPLRAETVCAYKHANVAIEKGSAVTVVDNSGRSRWRVRLGGAGTEVTLPGAVLALPPP
CQEALDAAAGLRSAYDRVIQLWQRKQLRMRQNMIFATIKVVKGWDFPQFVAMGAEQRQAI
RRALNEDAEKLLAEGDRADPQLRRLRREIDDVNRLFDEFERRARAEEDSKNAARIFTEQS
SQLLERLETLERTLHERIAAPVPRDLDALEHLVLQHRDWETALRALDGDVDTVQSTFRGI
ALKTPAMKKNLDKVMGKWNELQSKSQLFVERLKFVEIVVNSMEENNQTISEFEIKLAQFS
DLPNDVELLKDIHEDLLRMQVAVSKQQVQVDQMNDDAENCRRLVETSRAGLGHSLPRAGR
HADLERLDKEVTQLNQRWSSVCSQLAERLRSCEAAYQLLRTYNAGLVKETDWVDHATAQM
QATPVNEARAREHLEPTRNLFTTVVERTPKIEKVNVDGGRFIREAKINSSRCQRYVDWLC
EEVHPSLDARQLKRQADMELAERLRSRGSDVVPAEAIPTGAETVARELDELNAKHQRLLD
SLYERLRRIAAANPGDIVTLLAILVRSHSFKAPVSR
Download sequence
Identical sequences DPGLEAN14759-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]