SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN14760-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN14760-PA
Domain Number 1 Region: 6584-6737
Classification Level Classification E-value
Superfamily Spectrin repeat 2.06e-28
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 6145-6304
Classification Level Classification E-value
Superfamily Spectrin repeat 3.86e-28
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 5928-6084
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-25
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 5712-5869
Classification Level Classification E-value
Superfamily Spectrin repeat 1.88e-24
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 5175-5333
Classification Level Classification E-value
Superfamily Spectrin repeat 2.74e-24
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 6 Region: 5285-5440
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 7 Region: 7057-7133
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.75e-22
Family GAS2 domain 0.00053
Further Details:      
 
Domain Number 8 Region: 2365-2493
Classification Level Classification E-value
Superfamily Plakin repeat 2.49e-21
Family Plakin repeat 0.0026
Further Details:      
 
Domain Number 9 Region: 3002-3100
Classification Level Classification E-value
Superfamily Plakin repeat 7.59e-21
Family Plakin repeat 0.0033
Further Details:      
 
Domain Number 10 Region: 6385-6523
Classification Level Classification E-value
Superfamily Spectrin repeat 9.12e-21
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 11 Region: 6694-6848
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-20
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 12 Region: 1308-1468
Classification Level Classification E-value
Superfamily Plakin repeat 6.02e-20
Family Plakin repeat 0.0048
Further Details:      
 
Domain Number 13 Region: 4753-4892
Classification Level Classification E-value
Superfamily Spectrin repeat 2.77e-18
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 14 Region: 5391-5542
Classification Level Classification E-value
Superfamily Spectrin repeat 4.75e-18
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 15 Region: 3392-3523
Classification Level Classification E-value
Superfamily Plakin repeat 7.59e-18
Family Plakin repeat 0.0062
Further Details:      
 
Domain Number 16 Region: 3182-3311
Classification Level Classification E-value
Superfamily Plakin repeat 1.57e-17
Family Plakin repeat 0.0069
Further Details:      
 
Domain Number 17 Region: 2707-2804
Classification Level Classification E-value
Superfamily Plakin repeat 3.14e-17
Family Plakin repeat 0.0051
Further Details:      
 
Domain Number 18 Region: 6271-6379
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-17
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 19 Region: 4435-4572
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-16
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 20 Region: 2491-2621
Classification Level Classification E-value
Superfamily Plakin repeat 1.7e-16
Family Plakin repeat 0.0029
Further Details:      
 
Domain Number 21 Region: 851-1012
Classification Level Classification E-value
Superfamily Plakin repeat 1.7e-16
Family Plakin repeat 0.0023
Further Details:      
 
Domain Number 22 Region: 477-633
Classification Level Classification E-value
Superfamily Plakin repeat 2.49e-16
Family Plakin repeat 0.013
Further Details:      
 
Domain Number 23 Region: 77-224
Classification Level Classification E-value
Superfamily Plakin repeat 4.84e-16
Family Plakin repeat 0.0034
Further Details:      
 
Domain Number 24 Region: 235-335
Classification Level Classification E-value
Superfamily Plakin repeat 5.75e-16
Family Plakin repeat 0.0072
Further Details:      
 
Domain Number 25 Region: 3496-3604
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000124
Family Plakin repeat 0.0015
Further Details:      
 
Domain Number 26 Region: 348-460
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000235
Family Plakin repeat 0.006
Further Details:      
 
Domain Number 27 Region: 6967-7045
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000894
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 28 Region: 2900-3024
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000994
Family Plakin repeat 0.0047
Further Details:      
 
Domain Number 29 Region: 4139-4262
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 30 Region: 3934-4075
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000196
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 31 Region: 2806-2900
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000000235
Family Plakin repeat 0.01
Further Details:      
 
Domain Number 32 Region: 722-819,860-883
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000000353
Family Plakin repeat 0.01
Further Details:      
 
Domain Number 33 Region: 1161-1278
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000000157
Family Plakin repeat 0.0073
Further Details:      
 
Domain Number 34 Region: 2618-2733
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000000575
Family Plakin repeat 0.013
Further Details:      
 
Domain Number 35 Region: 5600-5724
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000088
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 36 Region: 4324-4466
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000155
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 37 Region: 3846-3970
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000023
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 38 Region: 1604-1693
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000111
Family Plakin repeat 0.011
Further Details:      
 
Domain Number 39 Region: 3108-3201
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000115
Family Plakin repeat 0.0062
Further Details:      
 
Domain Number 40 Region: 4680-4786
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000187
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 41 Region: 1502-1634
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000314
Family Plakin repeat 0.0077
Further Details:      
 
Domain Number 42 Region: 4974-5113
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000038
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 43 Region: 3686-3810
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000792
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 44 Region: 4543-4677
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000489
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 45 Region: 2241-2411
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000112
Family Plakin repeat 0.0093
Further Details:      
 
Domain Number 46 Region: 3609-3714
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000144
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 47 Region: 1034-1108
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000484
Family Plakin repeat 0.006
Further Details:      
 
Domain Number 48 Region: 2050-2123
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000902
Family Plakin repeat 0.013
Further Details:      
 
Domain Number 49 Region: 3328-3379
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000497
Family Plakin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN14760-PA
Sequence length 7416
Sequence
MQDLATTEHTYTTHYTTEKYVRTSHSSEVDGTPIKSMTNGKLNSPKYTTKTTISDDRPDI
RNLKRVHKMYEGPNIIESRGIIHPETKEVLTVGQAISMRILDVRTGRLLSSSTTKQTMTI
EQAAKEGLIDPKLAARLTGPCGMTEDGNEVTLLEAIQRELYDAEQGLADPAEKRIKVTVE
GQLPDQGMSISDALNRGQVDLQKGLYRLPNGSFITIAEAYQRGFLIYTEIIKIKSSALSL
SDAISQELIDNSGWILDRNSGDRFQLEVAIKNELINPNVREIVDPKNDTKITLAEAIEKN
IINTKHSKYVHPITKEKFSFKDAASKRYISKPMTLKDVCDHSLMTNDGKILTPINKAPLN
ILEAISVGILDSDNIKCVTDTTTGQLITLSEALGSRIILTDNKFRDNLTGEICTIPEAVD
RGLITSVSQRSIFDIDGFRDPKTGEFVSFNIALSRGNLKYVNGETFLKSESGDFVFLEDC
PKVSIVRPEVLEMFMRKIGVVEMGKELNVLDAVFKNVLDPKSGYLLDSATKKPIPFNKAV
EIGMITPEGAALLNSLLNITLTLQTVTKTVKRYVTVTNTNTTHRSETIITFAEAIRRGLI
DETTQTFTDPTTGTVFPIQQALDEGLLGIDPNESRVARISDRVSKKDLVPGQVVELKITK
KSFIKDLPPSPESKLQYENRPETVKSPDVVKTNEEITRQIKTVTTKSLTDPLVTAMTIKK
NTIELPQGGWTLKEAIQQNLFDPTTGMFTIPGTDRILDLQEAVSLKIINPNSAHVIDFKT
KKEIPLIKALEFRILDNTGHYKHNDIFLSMKEAIERNIVIFITLSESTASQKVITITSIS
GMPDKMEITDIEKAHSPILTSEDQSVLEPVQVVPGIIYDPATALVISTTSGISQNIIEAV
DVGAIPSDRVNVVDPINGQQINLKVALERGIVDKQTGNYKESSGKRISLVDAAKVGLIAV
VGSPLVAASKIIQVIKNTMVIDPTTGEELPMEVAYERGLVDEITYKNYEDSIRSKTPESE
NHKPTSTITAPKTLRSTMIVDPTNGDKISIEEAKSRGLIDSEENVTRTLLDQRKPGPSKI
PSKTSSIEAAVSEGFITVESIQNSLSADNKKTMDNVFLQKASSPVNTVVLHESQIPEKPK
YNINKLQKENKTPSCESKPLILQKLRKQVVMPSEGVSMGLVDRDTADLLNKITSYKDENG
AQLTLGKAIEIGLIDENKGKILDPQHGEFVSIKEAIVRGLLDSEGLNEILIPIAKKLSIP
EVLEQGLLDVNTGKIIHPETGSLLTLREAIICDIVDPMSVINIAPGHSVRLAEAISNNII
DSEKNIIKTDKQPLDLLSAVNANIFNEKLDECKNIPPAGMTLSVAIKNSVIDPKTGKVKH
PLTGERISINEAIKRGFLMDIPYPQSSSTITLEDAIKNNVVDLKDGTFTDIKTKEKMPVE
KAMEQGLLALKKDSSLSSRDGIVTTVTETFTSQHTITTKMVELLANYVLINANEVQNTIT
GEIMTIDAARSKGIIRDEQTSKEEFLTSDTSMTFEDALNLGYINIDNGTFTNPTTGEVIS
ITEAINSGVLNTESPSKPSEKSQPKDNKVELLDLKEAFDLLFDENTQKFYDPKSPDSKIT
FKEALEKKIIDPESVIYDVTAGKPVTLQEALNTGLLDKKSGKFREPETGKSVDIKNAAKM
GLVAVIAGPVLAGMAVAEGVKNIKSKITKLQQNDKQESALRKDKDDPNVKFIEVERKNNS
SIEHQVPQSKAMVEKASDVTKSAIDCKEPSVSQKEVTKKPFNEEPSDKDISESKNNQLPN
SDLIKRDSDLLIETQKEEPLKEHGYENITPTTSQSTAHSKEKEHKQLIVKKNEDKSAEEP
KQTALQKDSSVKEEIIANKPDIIKTREMLPSEKSETVTNFKDRNTKQDQENIQEFHQITP
DGQQVTTIVKTTISKSDPTVSTSEETTFVSEKVSKITTIEVTQNTSTTTHGITDINDHLN
QKKNKIDIHQDQVDKVSKDNQAEMQIFSTDITSSVSPKSNESTVKSLKEEKSESDAIPAT
PSGSISNTNLVDNTEQYKDILSAIDEGAIAQETILVTDYKSGRQINMKEAVDKGIINVNT
LEIENKDGKKITFADAAKIGLVAIVGAPILAASKAVEGVKKALAIDNNSPENINLDKSST
STTTPKSSLRHPEDVAIIETTQRQPITSGIHQESKQPIVNADEKTMSKLLIDAEKQPLRA
IDEITEQNTVKARIEPDKVLYENIPLIDAIAEGKIEPKVCRIIMNGEELALTVQDSLEQE
QISRFTPVDVVSKNCVIVKDIQPKYSLSVSQKLSPEELSEMGVYDIEKQIFLNPRTGAKI
SFEELVYSLNVFDPSSILVKDLSCASDNYVPFDEAISRPIIDKVTGHMVNPKTGKRVSFL
ECVQIGWVVEKPEDTFITKQITVESALEKGLYDPKTKQLKDVNTGDLVSMSEAIQKGIID
NESLLIKLPHSNEIISLSDAIEQGILEMRNGTIIIIETQETIEISVAIQRGIITISRRPI
SIEAVINKNMYEPTSGKIKDNITEQLVALHDAVERNIVHPTISEIKDTALEKYVPLSEAL
DTKLINPETGKLIDKKTGKHIPLDDALKRGFIATKSITFSLLDVIELGYYSPESCRVLNP
ANGEITTLAKAIENKLIDPIDIKIKNDNTETVIPFDEAVKSGLLDLEQGVITSPRFNLKD
ALDKGYLLSDKKPWSLQEGLVQGVYDPETGLLTINGKNMTLDDAIKKGNINPEVLTVKNS
VTGEMISLADAIESGIIDSKEGVVRDPVHGDKISLTDASERGLILPAKRKLSLPEAVFKG
FYDPNTGKFSNPQTKDKMPTERAIRKRLLDPQSTLVHVGGKVIPFEFAVDKGIVDGRTGT
ILIGNERIDFREAFERGILVEVRRPLSLMEAIEKGVYNEITGLFMDPQSGKKYSLAEAIK
LNLIDPNSVHIQDNRSGKWSKITLSEFMDTGMLDDKTGKIKNINNENEEISLAKALEIGL
LIDSKAPISLQRALHQGLYDDTTGKIIDPVSSRKITLHEAIRRSIISPKYLCYFYKKSEK
PLTLAQCCQIKVIDKTNGKFIEPGSDAQVSLSEALSLGLIVDIESAGFSLYDALAMNMYD
ITELTFIHPVTERKLSLKNAISEELINPETSLVKHIPSSKYMKLAEAIEAGVIDENNSAY
ILPNGNTVNLVDAKHRGLIVTSKKNLSLEEIIKNGLFRADNGKIVDPSSNEFVTIDKAIE
NNLIDPNLTLVKDGSTGKFKPLIYAIRDGDVDVIKGRVLDTKAKKTYSIDKAFDKGLLVT
VIPPLTSQRVTKQYVPDSSDSKEPVLREFTLDEAIKYEFIDPNTCLIKDPHKNKYIPLKL
AITEGIIDKNAKGLFDTQNRSRMRCFTFENCLIVYTREPLTFEQAIENGYLNINTARFTD
PQSNEVFTIKDAATLGYIDSDTALIKDNLKKRLVKLPEAFRKGLMDAEKGNILDTETSKL
NSLSAAIESGLLMTPKKSFTLIETLNFGIYNPTTGALNDPFITTSVIDRKRLTLGEAIRQ
GIVDPSSTVVKEPETGKICPLVQAIEQQLVNPIEGRIVIDPKKGISLDLVKALKKGYLLP
AETRQAVEEKYRLCDESLSKLLEWIAVVEERLANQEAVREDMDELRNQINVLKLIKDDLE
THQRQVSACADQAKQLLVSGGDVLAPHEVAALERGVRQLKQRCDKCSERCDKMLRRMIAA
RDELGKFTNELNTFNSWMESAYRTLEDKEVALSKVENLTGQSDDVREFVSDVIAHQADLR
FITMAAQKFVDESKEFLSLLNDYRTSLPARLSHVAPPVDSIVREHAALARRRHSDLANRA
QRLLDRLRTASDGSARYREALQRAQRWIQTVEPQVQSCVSETAGGDPRALDTQLTRVKAL
HSELRAQGRLVDHAHDACEQLVKSLEGNLTPAEIRQLEIPVVELNDRYNELDNALGAKCS
ELEAALLQCQGLQDAAETQAQWLSTVESSFKNQSKPASLIRERLDEQVREQRSSHSELEA
RRPTLNKLLATARDAATTPSNARIAKKLEQRAEDICARYDKLLERSAKRGVHLEEVSAEL
TRFTQAAATLEAARTQLGDDLRDGKITDILANRSLAIKREISGEVADDLCFAFRDKQMPL
LEECLRNGKQLISKPDVTDTHVVRDRMKALENQWRDFNVMLEEKQKLSKQKADQLNQYES
LRMQVLEWLQNMEHRVNHLRPVAVDLEVIKQQQDELRPLAKEYRDFSVNIDKVNESGALY
EALSRGERADSPHRKRSLYSPTKRHTPSRSDGRSPSPVKSRTLVSPASASSGFSSRRSSQ
DGFHLDELSPVQQQVSEINNRYELLGTKLADRQTELDAVKEEVRKHYDSLRQLNNFLDKV
QRQLPKESVPNTKEEADKTIKQARAALEEMYEKQSILDSTKTQVRELIRRKQSVEGADRL
NDEAEETAARWKALHDAFKDKIHVMEEMKDFHDTHSSLTQWLGSKERMMAALGPISSDSR
VVHTQVQQVQVLREEFRSQQPQLSHLEQVAASVLQRLDPHQHDAQKLEAKLRQLQERWND
LLSQLEHRAESLGAAADTSRELDAGLARLKNALHAIGDKLDDVTEHDPHDQLREVENLER
QLEGQRPLLADLEAAGAALADVLADPGSRQDIQGKLAAVARQYDNLQRKLDNKKAEIEAA
LKDGRNLEASVSRTLGWLQSSLGGLPSRLLVSADRPTLQHQLDQHEPLYRDLTQREHEII
MLIDKGREMEKKPAHQNLRKDLDRIQTQWDKLKREIIDRQTRLQTAMEHCRKYSKAQESF
VPWLVEVERRQATRPPLALTKKDVEKQLKELQQIRNDVWKRSGEYENNRTLGETLISACD
VDQDVVRRQLDTMKERWDRINNEVLQQVEYLESTARKLGEFLERVRAVEAPLARCEERLE
TALSAPPAAARDQVARLADHVHALRAPLQSINIAADDIVALAMENGGEEAGARARQVLEE
TAKNLAERLQDLEKRTDDARDKLAGAAAAYSQFQDKVKNVSHDISDLEKELDAMKAPGRE
IKTVKAQLDDLARYYKRLELADDLVAESAKAAEALVDSGFAESAKARDQVESIRKQLAKL
DERARAKEQDLDDTLSKLEAFYKAYDSVMDDVDEATEQVRSLKPVSSEVEHIRAQQKDFA
ELKKHTLEPLGLNVTHCNRIGQGLVRSALQGASTGQLEKDLEKMNDKWNALKDKMNERER
RLDVGLLQSGKFAEALAGLEKWLADTEDMVNNQKSPSADYKVVKAQLQEQKFLKKMLMDR
QNSMSSLFAMGNEVAAGCDPAERKAIEKQLKGLMQRFDDLTTGAQQRMLDLEQAMKVAKL
FQEQLQPLLEWLGTTERKVKALELVPTDEEKIQQKIREHKVLHEDILSRRPQFSQLTDTA
SQLLSLVGDDEAAALADRLQAATDRYQALVDHSLNIGSLLDSSRKGLRHLVLTYQELSLW
MDGMEQLLARRRLLPVHMEELLRQMDELAEKTEEIAAKQEAVDSTVESGLELMKHISGDE
ALQLKDKLDALQRRYNDLTSKGADLLRIASETLPLVQQLYNSHNKLSDWLSSAETCLQSV
DPREEDILRLEAELQEFRPLLDNINLVGPQLCQISPGEGAAHVEGVVTRDNRRFDAVAEQ
VQRKAERLLLSKKRSLEVVGDMEEVIEWLRGADSMLRSAEPPAGDAAALRAQLAQQRPLS
DDVAAQRARARDLLGQAKKVLRECQSSDEAAIIRERSDELKEMMEEVAALSAARLAALEQ
ALPLAEHFADTHNGLSAWLDEMEKQVSSLALPALRPDHIAQQQDKNEMLQQSIAGHKPLV
DKLIKTGEALSKLCGEEDAAKIQDTVEHDCDRYNAIRAELRQRQQELEQALQESAVFAER
LEGMVRALSGAAEQLRTAEPVSAHGVEQMDENNALIEDLDKRQEAYRAVTRAASDVMAKA
SNSDPAVRDIRAKLDKLNKLWAEVQKSSSERGHSLESALEMARKFWQQLDTVMSALADLA
DSLAAQPPPAAQPADIQAQQVALQEIRHEIDHTKPEVEKVRKSGSSLMSICGEPDKPEVK
KHMEELDSAWDNITALYARREENLIDAMEKAMEFHDTLQNLNSFLDTAEDKFSRMGPLGS
DIDAVKRQIAQLAAFKQEVDPHMVKVEALNRQAGELTERTSPEQAASIRQPLSAVNARWA
ALLRGMVERHQQLERALLRLGQLQHALRDTLQWIQHTSDTLDTLAPVAGDPQALEVELAK
LKVLVNDIAAHQASVDTLNEAAATLMHQADGSDEAGETAEKLTLLNKKWRELQQKARDRQ
AELEDALREAQSFNLEIGDLLSWAVEVDAAIAASRPVGGLPETAAEQLDRFMEIYNEVEA
NRPKVEAVLQQGQEYIKRQAKPNPTSQLHLSLKNLKTRWDNVTSRASDKKIKLEIALKEA
TEFHEALQAFVDWLTSAEKTLTSAKPVSRVMETLLGQVEEHKLFQKEVSTHRETMLQLDK
KGTHLKYFSQKQDVILIKNLLVSVQHRWERVVARAAERTRALDHGLKEAREFNDLWNNMM
SWLEETDKQLDQLNSETAVNDPEKIKLRLNKHREFQKALAAKQPVYDQTTKVGKQLKDKA
PKTDEPVLKNMLTELKTKWTTVCSKAVDRQRRLEEALLYSGQFKDAMSALLDWLKKRQAT
LSADQPLHGDLDTVMALIEQHKQFEEDLHSREQQMQSVLKTGRDLEATVPPEDAQNIKLQ
CSELTSAWDSVVSLAEKKASRLEAALKEAERLHKSVNLLLEWLSDAESRLRFSGQLSEAE
HDAQQQLADHERFSAELKDKQRDKDDTIALAHSILAKAHPDAVSVIKHWITIIQSRWDEV
KSQSQGRETTPRKISAKTAIRGTPSRGSQHDLHRDRSASPDYYGTRRYSRASPGRESPER
LPHYGPRFPPKGSKGSEPEFRSPRVKQLWDRWRNVWLMAWERQRRLHERLAHLRELQRVS
NFSWDEWRKQFLKFMNHKKSRLTDLFRKMDKDNNGLIPRNEFIDGILNTKFDTSRLEMGA
VADLFDRNGSGLIDWEEFIAALRPDWVERRGPPTDADKIHDEVKRLVMLCTCRQKFRVFQ
VGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLVKNDPCRAKGRTNIELREQFI
LADGVSQSMAAFRPRTPRSNTNTPPSTGPITKAFFGFVLMRLAEEFMEQLRPIFEALRQR
EELPCSYPLHVGSTHGTKQAFIYGHSRSQGSTTPGGHHYTHHHGYQPSPGYHWVRERTVR
SVPMSSGPAAGRASRSSLSAGTPDSLSDNEAASGLGQRYRKPSVPRSTLTPGGSRPGSRP
GSRTGSKPPSRHGSNLSLDSTDEVLTPSRIPMRKVTNTRASLARAAATASKLGTANGASR
PRTPTGALTPASRYGGTMYRTSSIPTLSPAPAIVRY
Download sequence
Identical sequences DPGLEAN14760-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]