SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN16873-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN16873-PA
Domain Number 1 Region: 166-436
Classification Level Classification E-value
Superfamily L domain-like 2.47e-36
Family Ngr ectodomain-like 0.063
Further Details:      
 
Domain Number 2 Region: 607-729
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000000183
Family Toll/Interleukin receptor TIR domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN16873-PA
Sequence length 743
Sequence
MVLAPILFSCFFANIVNCQISDRCLSGYMTDIQSWVDRFGYFTENVDFKSKLDLSGIQGP
MLKIERYLKEFELKRYDRIKYFSMTKCGLRSIPDVFHLQDHHGRSLAETIEYVTFYGNEF
SMNYLTRDADDDVSPEINLTSFNGEEIIIKERYQYLSSWGAGFKDVNFENLLQLDLRACG
IRSLGSYAFKSMPKLSMLYLSENNIYHIEADTFSGLHNLIHLDLSRNDALDDVYKTISFN
FENRHEFRGLRLVSLDLSYSPFGDNNIPMLKDLKQLKSLSLCFSGLRRLRPRTFDGTQLR
FLDVSGNKDIFDTRSVLGGLENSLQVLYAQEVNMKTIDCLYNLTYLEIAQLRKNEIAVVR
QNVSITLKKLQVLDLSHNRKLAWFSKVFSLMPKLKLLSLNSNNMNVVTQEMLDDFQDLSY
VDLSYNFLICSCALRDIYGISINNEYSVEHPLIEFERDNEGDTLFLNNGLTYFNNIITRR
QNTSILNGNRTLRMDNVFQLRGNFVLLVNKNDPYRFRCLIASEGKLTNVNKIMECTNLNR
NYDIEQADEAKWRFFLLFLIPVLLLPTLIFMYMYRRNFKYFWINLKNTTTLSLINKDVII
NDTTIFNYDAFISYCNEDRAWVLDYFLPHVEQDCNISVCLHERDFQNSLLMMMMQFSSLE
FNPHLSRPSLTSKLLETRREDLILVLLEEIPRRLRPNTLHYLMVTKTYIVWPSEEPQRNL
FWKQLKKSIVKLKLIHSENVSLA
Download sequence
Identical sequences DPGLEAN16873-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]