SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN17130-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN17130-PA
Domain Number 1 Region: 431-523
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.44e-17
Family Eukaryotic proteases 0.01
Further Details:      
 
Domain Number 2 Region: 23-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000759
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 203-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000082
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 4 Region: 59-98
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 5 Region: 143-185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 6 Region: 108-141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000995
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN17130-PA
Sequence length 543
Sequence
MACNGLSDPLSDLMIRRPKRQTQNCRKNQWQCRDGTCIGFDGKCDGVVDCPDFSDETFAL
CRDMQCQSNWFRCTYGACVDGSAPCNGVQECADNSDELLPRCRNQTIGSRGKHTCDNGQV
ISSVDICDGKKDCADGSDETLATCAGNSCPSYVFQCAYGACVDQNAKCNKVEECADGSDE
TDELCNRLAPGQPVTPATRPPPQGGNCLLPPYPQYGSYKVRQYPNAVPGQRYPNVRLDVT
CNPGFQTENNNSIFCDNGEWSGPMPACLRFCRLNKHPSVEYRCLLSGNSVTGSRECGSLE
PSGTVVTPICRSPNYYSSGVMSNMHCVEGSWDYIAVCKPGLTNVTISIDSLEIIITSDNA
HVIINNYGNKEVKVVNNISNADRIVFEDSRTTTSRPTASRTTTSGPTSANYDNEIDEGDW
RMASVDTIGFQAQPVRPKKCGTITPEGIQLVIGGRSAKRGELPWHAGIYSKLFTPYMQIC
GGSLISTTTIISAAHCFWSDTKKLLPASEYAVAVGKLYRPYNEKHDADAEKSDVRRKYIT
SNT
Download sequence
Identical sequences DPGLEAN17130-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]