SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN19391-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN19391-PA
Domain Number 1 Region: 64-431
Classification Level Classification E-value
Superfamily L domain-like 5.27e-50
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 2 Region: 366-685
Classification Level Classification E-value
Superfamily L domain-like 1.7e-49
Family Ngr ectodomain-like 0.037
Further Details:      
 
Domain Number 3 Region: 762-934
Classification Level Classification E-value
Superfamily L domain-like 1.02e-29
Family Ngr ectodomain-like 0.0035
Further Details:      
 
Domain Number 4 Region: 1029-1183
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.67e-20
Family Toll/Interleukin receptor TIR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN19391-PA
Sequence length 1322
Sequence
MVIGARARSAPPAPVGCQWDYSDTKLSESNFLTCNIKTIGSADFLFKNITTAQAYNINKL
KLTCTDLLFFESSLHMNTGSFLGQLRKLEELQIDYCKIRYVPATVLSPLRDLTTLSLRSY
NTDWPAMTMEFHAESFRGLMELRSLDLGDNNIYMLPSEVFCPLFSLESLNLTNNRIQDIS
DIGFSDWGKGPIAPGKSCNTGLKMLDLSHNNILRLPDNGLSSLRSLEVLNIQNNLINEIG
DRAFVGLNSLKTLNLSGNKLVAVPPELFQSSRVIREISLANNSLSVIAPGLLEGLDQLEK
LDLSRNRLTNDWVNRDTFSGLIRLIILNLSYNSLARLDPISFQDLNNLQVLNLDNNEIKL
ISNGAFAELKNLHQLSISDNKIKILNENIFSNLFVLSQLYLDNNEISSIHDNCFENITYL
QDLGLNGNNLNVIPSSIKRLRFLKSLDIGKNNITKISNTSFEGLEELYGLRLVDNYITSI
PKDTFSSLPSLQVLNLASNKIETIEQNAFVSNPTLKAIRLDGNKLTDIRGVFNKLNTLGW
LNISDNKLIYFDYSYMPESLEWLDIHMNNITKLDNEQNVQQNIRMLDVSYNSLERVDEMS
IPDSIQILFLNNNKIHTIHPGTFIQKRNLEKVVITDNKLRTVELAAFTLPHIPKHRTLPK
FFIGNNPFICNCHMIWLQKINLWNHMRQYPRFADLESVTCEVVSNKYGGKANLMDVPETQ
FLCSYETHCSSSCFCCDFEACDCKMTCPEGCSCFHDSNWNSNVIDCSNVGYTEIPEKIPM
DATELYLDGNDFGTLGSHLFIGKKKLHKLYLNNSNIATMDNDTFNGLHSLNVLHLENNHL
TELAGGEFSQTKHLRELYLNDNFLTSVGNSTFENLSSLRVVHLQGNKILDLDKKLNHITH
LETVNIKGNIFTCSCEHLISLQNWLKKHNKDPSDMMCFETSLNMTVFDVTDKCHDSIVTD
NTIPTENQPFQYDEISTIKLNFVPLLAVVLISVILILLFGALAFSFRQNVRLWAHSKYGV
RLFKSASIQESELDRDRMYDGYAVYSLLDDDFVSRVVAPEMEHFGYTMCFHYRDLQHVPE
NYLTEQITNAAESSKRILIFVSFNFLHNEWSKTSFKDAIKHVITTIHPSIRRHRVFFILT
TDVSALNLDVDFQSYLKNCNVLIWGEKKFWEKLRFLMPDISNLQWNKETNNYNHGVCPNS
RRNPSRYTASPTAPELWYKYDALPPQTPSTTNVGITVEDDTSMLTNTTLTSQIQEIDNPH
HSYISIDTQNYEQPYGGRPRPPNTIRKHTVPHSPSMLDEQGYLQPRSSVHDCLPQTHTAV
HR
Download sequence
Identical sequences DPGLEAN19391-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]