SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN20237-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN20237-PA
Domain Number 1 Region: 351-666
Classification Level Classification E-value
Superfamily L domain-like 6.12e-46
Family Ngr ectodomain-like 0.022
Further Details:      
 
Domain Number 2 Region: 1006-1153
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.31e-38
Family Toll/Interleukin receptor TIR domain 0.0000982
Further Details:      
 
Domain Number 3 Region: 728-907
Classification Level Classification E-value
Superfamily L domain-like 2.52e-31
Family Ngr ectodomain-like 0.0027
Further Details:      
 
Domain Number 4 Region: 78-356
Classification Level Classification E-value
Superfamily L domain-like 3.2e-31
Family Ngr ectodomain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN20237-PA
Sequence length 1222
Sequence
MALQTCSRKSIFGQIVFWLIIGPYVTDQSSLPLKYEAPDDCQWWLKGPNEAHEVSLTCKL
RTINSEFDTTNFSVIPSEHTTSLRIECNEEMMYKSSLDDRSFAHLIKLRELVLDNCKIGR
WPPGVLSGLRDLRNLTIRTKNTEWAAMSLEIASESFTAVRQLEKLDLSYNNIWSFPENLF
CPLTNLVYLNVSSNRLQDVSDLGFRERAMHQALISEHEGPSPSTSTSPHTSCSLDIEVLD
ASVNQFVLMPENGFMALRRLKELHIHDNEISMVADKALSGLKQLQIIDLSNNKIVALPQD
LFRDCRPVIKEIYLQNNSISVLSPSLFANLDQLLALDLSNNHLTSTWINENTFTGLIRMI
DAYALNGLYVLSLLSIDNNHLEELHPEAFRNTSSLQDLNLNGNRLKKVPTALKNMRLLRT
LDLGENQIMSLEEPGFVGLHNVYGLRLIGNKIENISKEVFTDLPSLQILNLARNKIKQID
MDAFETLSNLQAVRLDANQLKDIQGLFVNIPSLLWLNVSGNQIEWFDYAVIPVGLQWLDV
HSNNIKELRNNYRLDKELRLQTLDASFNLMTKIFTYSIPSSIELLFLNDNQITQVEAQTF
VGKTNLTRVDLYANQITSMDLNALRLTPVDPGRPLPEFYIGGNPFQCDCTMEWLQRINKL
DHLRQHPRVMDLESIYCKLLYNRERTYIPLIEAESSQFLCTYKTHCFTLCHCCDFDACDC
EMTCPSNCTCYHDQPWSANIVDCSGAGYAEIPNTIPMDATELYLDGNNFGGLTSHAFIGR
KNLKILYANNSNIDALYNNTFSGLKRLTVLHLEKNNIKELLGFELSPLENLRELHLQDNK
IHYIDNRTFMELRHLEVLRLEGNNIYSFAVWQFTMNPYLVEISLSRNPWSCDCQYMHKFR
NWFKNNLGKVEASDKITCIFDNVTNAVGPLMSDFNSTICTSHVGGSSSIIENQVINDYLP
LLLISLFVFVMSSALICGIFYWRRELRVWVYYHCGFRMCYKSTAFDDEADKDRLFDAYIS
YSVKDEAFVAQMLAPGLESTDPSFRLCLHYRDFNASAYVADTIIEAVESSKRTIIVLSKN
FINNEWCRFEFKTALHEVLKERRRRLIIILLGDLPNRDMDPELRLCLKANTCIEWGDRQF
WQKLRFAMPDLRKCQYHRSTVNIYASVSPVGAGRAPAPTPPPPPGKLPPLLADGLADRLG
MPTSVHRDHHSHRMPPHAQLWA
Download sequence
Identical sequences DPGLEAN20237-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]