SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN20255-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN20255-PA
Domain Number 1 Region: 103-196
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 2.35e-19
Family Chemosensory protein Csp2 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN20255-PA
Sequence length 202
Sequence
MLDKFKGGGPKAIFDIVTAHSAKRTVEYLAMAGLVIESNPPYCTELAPCDFYLFQELKIK
IEVFILGALKMRSTINMKIVILLSLLSVVAANDHFYYNLIPLEVTALAKNPKQIFEFLDC
LLDKGPCNDVFEGYRAVSLEAVQQACKRCTADQKRFGNIFLMLLRKLLPQEYHNFRYKYD
PKNKYFDALEAELSKYKYLPCL
Download sequence
Identical sequences DPGLEAN20255-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]