SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN22201-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN22201-PA
Domain Number 1 Region: 686-723
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000943
Family Ovomucoid domain III-like 0.019
Further Details:      
 
Domain Number 2 Region: 732-760
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000291
Family Ovomucoid domain III-like 0.0083
Further Details:      
 
Weak hits

Sequence:  DPGLEAN22201-PA
Domain Number - Region: 564-606
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00652
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN22201-PA
Sequence length 939
Sequence
MSLVEMASDSAMREERIENIYKFCAPHLIEFWICMNQTIQEVVSRSGWWGRACCALGHSA
KCRRACATASDASALSEPCRRSDEINFFDCVQKQQEGQWCCSQTRSISCHEACQKAVWRV
GQTRADSGAREKAAELCEQSPALLHCFRDLTASTVHTDTSKYLPCCHESPSQECRSTCET
VLRRTGESQEIAEALSQECGAPAIHDGMWQCFLRKDAPPETKDVIPHDVAKLHCCQKGAT
INCRRLCFYTFNNGWHLNWQKFYSECLGDPQETEMAECIEEVEAPCSLGCAGLTYCSQLN
NRPTSLFRSCSAQADLDAHLAVAEQKASGDVTVAGLRLPLKNSSQCTTDIWKSVACALHV
KPCTLKGHSSLLCAEECRRLVSSCVEWSRAPLSAAALCARLAPARPDAPCVSLAEFLTAS
PEPPLLSATEMVTSPCAGSPCNSSQVCVINRSCIRGGSCSKYTCIDGCPLGDGSPYVVPV
GSWVRVPMPCAAQKVCIKICRCGNKGLSDCQPLPSVALDNCRLHDKVVKHGDKYYMECNP
CVCVSGERVCARRACGRAALLTGLPCNCPPHHLPVRSPGRLYPNACLAKCAGATDAEIEF
GSGGVCSGGECSRLACLPARSVCLSRLQTACPQHVCAGATDAEIEFGSGGVCSGGECSRL
ACLPARSVCLSRLQTACPQHVCVSTTNCHTQPPSPVCDTDGHSHSKPCQLIMSGRRFAYW
GQCLQGCSSSGTVCGVNGITYSSECAAWSEYVSVDYNGACFAVGPISDLMEPKCQFDRIM
CPPLKKPDCLGYTAPGACCPKCGGALRILYSKKQIDRALYGTNISASVINLHNVLSALDR
HVKVAECALRGYLTIEMEIFVTIESVLKNPTDLQLNVCVLEAEKLADLINRESALISSDL
GLSALSYALIVHTHPSQGASVVSLSLAIILSYTVIFVLR
Download sequence
Identical sequences DPGLEAN22201-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]