SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00001513 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00001513
Domain Number 1 Region: 116-291
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.53e-44
Family CRAL/TRIO domain 0.00011
Further Details:      
 
Domain Number 2 Region: 29-106
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 2.35e-16
Family CRAL/TRIO N-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00001513
Sequence length 311
Sequence
MGKAECISYDEQQLPYIDLGSARIRMEKDPAPEWALKKAQDELREVPGVKEQAIKDLREL
IQNEKYLNLPMDDEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGIACENIIPSKLRNVF
EANILNLLPQRDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGSMVEPYSQICGAV
VIIDMEGLPLSHITQFTPSFAAMMLDYIQECICMRLKAVHIVNNSYIFNMLFAIFKPFIR
EKLRKRIFFHGKDYKSLISHIEASALPPKYGGSATWELPPGKLLGEFFECYSKDYELADS
YGYTEGYKMKK
Download sequence
Identical sequences DS10_00001513 XP_016945893.1.48971 XP_016945894.1.48971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]