SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00003373 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00003373
Domain Number 1 Region: 328-622
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.85e-56
Family Rhodopsin-like 0.00053
Further Details:      
 
Domain Number 2 Region: 113-292
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.35e-33
Family CRAL/TRIO domain 0.00059
Further Details:      
 
Domain Number 3 Region: 30-104
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 3.66e-17
Family CRAL/TRIO N-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00003373
Sequence length 2300
Sequence
MPKVWTVPRGVCVLCPEMANLRPLSAELRRIAETELNEVEERLPADLQALRDWVAKQPHL
RARTDDQFLVGFLRGCKFSLEKTKSKLDHFYTIKTLMPELFGRREVDEKTLTLCRTGTYV
RLPKPWGPGGPRLQLTNYEKFEPKQFKLLDLFRYQTMISEQSIIDDDNSNVSGYVEIIDM
AKLSVSFLAQLDFTLIKKMGIFAEKAQPTRLKGVHLFNCPKEGVALLNLAKSLMPSKLQQ
RFQVYKNLEKLNEVIPREYLPEEYGGTNGRIADIQAEAEKQLLSYKNYFAEESKYGVDEH
LRPGKRFDFSKWDFPAERIWLHKSNGEITWKICTFVPLIAFGLYGNFTMVYLIAANRSLR
SPTNLIIANMAVADLLTLAICPAMFMLNDFYQNYQLGYVGCKMEGFLVVVFLITAVLNLS
VVSYDRLTAIVLPMETRLTVRGVQIVVVCTWILGILFASPLALYRAYRVRIWKNFTERYC
KENTSILPKYWYVLITILVWLPLGIMLICYIAIFYKLDRYEKRVLSRENPLTVSYKRSVA
KTLFIVVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIY
GFNNENFRRAYYQISWVRRWREAAKMKKLSGKSKHCCYCDFMKRGKPKTDEPHQSGNVER
DMTVGLEESDELAHVHHALLGVEELFTKVFESPLSLTWFRSHHADLLPPQSLDGAPELLD
ILRVTFHADDARFSRSAEATSFSFDGLTRVSSVPVSFPLDICMLQLPTVKYATALHKDAT
GLRHFAVFTWRPAEKDYQLLVELAAPQAVALDCLAFAGRGYVAVSYNLTEPVGQAREGSP
IYEISPETGIRTVQYFSGTQLRGMYLRISSQELTLLQAFEEEASCPYFKWMGMSFQRLGA
IPCSSARRLEAFGIDYTDYVAVANYADAEGRTATRSEIFRWDAKSQRFQLFQRLRSNGAV
DVKYFSLPVNEVSRRHFLILSNTIGGSSSGVGEADTVIYVFEKGQFVPYQRLSFYAVERV
LPVQHSISEKFLLLVACNKQDVKIYNLNDWRFEESKVQFTEGALSRGVARMRSYEEGDYS
YLVIANENMAANETNIFQPLYKQDEHANILRQQIIDWARDQRKRLEQVNVEQLLKRLEEK
LKQREEKLGWSEIKEVKAKSFEDKHMKLTPNYWKALQLTKQALDAIEEKIIPASTRHPVK
RSVDRLHEEHDFEEVTVDTLVVHGTVKADHINRVDTKNHVYESVTASKVYVSEKYTEPLR
KQRKPLLEELTVKELQLEGRLNGLKWSELQDQTLKRIGKEVQFIKAAVDLDHFQADAVQV
NSNEVNDRPVGQLIPVDGGDFVVQQDVQFAQPIQVNRLLINQRLNHIHVDRQRFDVLLRQ
ANHTQVIEGAKRFENVRVMEPITIAGQMMGAELRAMSPAKVNHKSLQLQGDFVIEGDVTI
GRLLQMSDFVDEPTQRSAAESLIRGVRLDQLVENVNLNFLQPLIANNTELSFLNTQDLQN
LVQLNVGKVQLVQASKIFPQNVEITDGFGEVKWLNGVDTEKLPNMLLSKSGNQTISTPMQ
LHGLEVDELNSSQFLLNGLGLEDYLQVNKDQKSNGTLFVDNLDAEELSVEDLHLNGLLFG
QPLSSIYEHGSKSLDSWHLPPDFNGTLHAQNLWLSGELNQVNVVHLEQQLQQLAGNIKYV
GDISFEHDVNISSLSFENSLNGIEAHRFGRCWLESEGDQNFTAPQELASLDSSKGVWLSG
QLNNHTLEDLVSCSYRLNGSEHLQAVRFENPIVLQSELQLGKVNGLRVPEDIIYHIGGGY
LSAPVSIEGNLEAAETSNITNLNGYPLAALEKYLSGQTLDTFLAENVKFGGGAPSYKLLN
GQELGKLLDQVWLDNEQIELRGLELDSGQFKGLLEFQGAINKQHVDHIRHNYFSRTRSNQ
MKTPLSFQHDVTFVQPPVAKYVELRRGTSDVLMEGRGSNFSLDFNDIVAHTLKTGGEHAI
SGKWELANVSVSGDLKNVLINQLNLADDIVRIPENNKSSNPLTVEALKTVTSATINRLHS
TPGSRVAEVPLVQWINEAAYIYGNHSVSGTTRLDNVNLYNDLTVKGTVNGVLWQPDKLLL
RDKEQDVRGSLLVANSLPESRRIFSNNVENLWVDSVNGLPVNELLDNKAQNRPDLHVESQ
LIFTQPLTVGLYEVSNGNGLLDKYYKRKRGIDAIANEAWQQLQENVAAVRNRLDKPPKVL
ENFALLQKLPHKASALKIISSNNIDTLAIWEQKSNNAILYTWQPDRQLFALNSRTFEFGS
NLKLTNTFKIQRCGTHREAL
Download sequence
Identical sequences DS10_00003373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]