SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004141 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004141
Domain Number 1 Region: 272-463
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.84e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000213
Further Details:      
 
Domain Number 2 Region: 99-232
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.35e-23
Family CRAL/TRIO domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00004141
Sequence length 476
Sequence
MDDHSRFAPRLPGPAINPIVDNSDEPQPSLSDLHDFEPKLEFDDTELLAPSPLEKDVMVG
DFVLADDPELEPEEDVNPLEDDFEDQLREQSENFQAPRNKCDFLGTDKQGRHIFGIYASR
FPEKSQLEGFVREIIKEIEPFVENDYILVYFHQGLQEDNKPSTQFLWNSYKELDRKFRKN
LKTLYVVHPTWFIRIIWNFFSPFISDKFRKKLVYISSLDELRQALGLNKLKLPDNICDLD
DKLNPSRKPSTPPPSTSINASRQQQHKMATTHQFGVPLKFIVVNSPCLNSIPPIVRKCVD
SLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVDLKSVNVHVIAGLLKSFLRDLAEP
LLTFELYEDVTRFLDWPKEERSRNVTQLIREKLPEENYELFKYIVEFLVRVMDCEDLNKM
TSSNLAIVFGPNFLWSRSTSTSLEEIAPINAFVDFVLQNHKDIYLIDVNQRTVSVD
Download sequence
Identical sequences XP_016934449.1.48971 XP_016934450.1.48971 XP_016934451.1.48971 DS10_00004141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]