SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004418 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004418
Domain Number 1 Region: 495-651
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000273
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 2 Region: 275-393
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000136
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 3 Region: 3-162
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000249
Family CRAL/TRIO domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DS10_00004418
Sequence length 1270
Sequence
MEEDVLNALQTRSAYLSGGFDRQKRIIFVVNAFNDLQLWNRRYLQVTLDYLKRSLSASVL
QNGVSVVVNAQESSSRISRQQVRQIYSLFGGDINVDLYLVRAEGFWEKHVEPCTKSQVKG
EPLVLSKARLFKFIEPQNLPEELGGTLQFNYDLWLQQRKSIDEFTKSHVQTLASMEKLLA
LLREHKSLRPAEADVELKKCAQLHAGVQNDIESAIDMGNAILARFNEVYETHSPPPQAVA
PASESPASPPPIPVHSATAVPPQQQKPLLPPDLVCERARIELRLNEIEKKQTAIRTAWLE
LLRSLREARELSTLEEGVSFVTNWILQQAEQLLSRQRSIAGDVRGSEALRSAHDQLEMEC
RETYGCYAELLYKIERFAGERQASPKDIELCQDLLSQRDFMQFVCRSFAKRLERRRNVLM
TALRFHRLLEQFEELLTTGNHVVEVDSRALDWPEAEQLLMQLKNNQEMMGHVERDLVREG
EKLSDMLAMPVKDALGRDLQLDYSPEIAQLRRQIDESRRRRQVCGHRMALQRLTLEQVTH
IHAYEEDARRARDWLQELYAVLLRCHSHVGCNIHEIQLQKDELQGFEETGRSIYHYGCQL
LEASQTLRLCCNMDPSGSRSQSNPGQSLISDELQHTWHSLQSVAQEQMTRLRVSAVFHRS
VEAYYRQLRELRPLLTQELSAQLQQQQRQQHNRSSSGISSDAEGEIESELSPLGEMPPRL
QRHLVAREQLLVEVGRMVRLGRLLKKRLKEPFVLDALTGKRFRNLFAKSKGDEDVEQEVT
PRLEVPSIVVDEPPNEVEPPVEESENKFPNGDQNLTNTSAPLAAEEEDLAGNPHEVLSDS
SSDLSRLLEAIDEASKLPEVSSEDTQGEDEDYEDDDDDETASTSSVKTKIAKASIERDII
PEETEEEEEDEVDSGPPLKSLDKIKALIRNDSETYPHSDYTDNETPSHSRTASVDSGAPD
NPRLSGDFSVVADELPLDSSPSPLHDSGRTSSAGSEVPAESPPATVQVVPTGSNELACAA
ISHKLGAIAEVAESLDAVIRDVQQQEGAASNGITNGTAGHGIKKLGSIEDWHSRSTEDES
FATASEGNFTPNSHSSSFQTASGRTSSYIGSAKNSFDEADDSTLSTFEIPELPTSPVNMS
FDSSELSYFSAHQQRVKSEDQDSVVGVAELHSQSVTPTPDDEEQQHLLLPLPLPQAIESD
SEVEGFSLATGITTEMTPRIPNAHTPEVSYLSADNTAPASTNPNESKPPTSWRRSKYYEN
ITKQTIKGFL
Download sequence
Identical sequences DS10_00004418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]