SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004496 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004496
Domain Number 1 Region: 842-915,996-1085
Classification Level Classification E-value
Superfamily RUN domain-like 4.97e-33
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1240-1309,1349-1435
Classification Level Classification E-value
Superfamily RUN domain-like 6.28e-24
Family RUN domain 0.017
Further Details:      
 
Domain Number 3 Region: 1094-1187
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.38e-17
Family Lipoxigenase N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00004496
Sequence length 1446
Sequence
MTTRENVVASRLSKLMLSSTSGSGSGNGSGSGSSNNQVPPSPTSPGEQSQSQSELNQLKR
DADPQFSRFADYFVICGLDLDTGLEPDRFAGDNLHCSPLDRAYKSKPLAHYPENVPWNPF
DAHGICMLSLPQGLRFRTQKHSIEPRFHSFATTREDGKRCYGFSLVFYEEIRNRNICGAI
HTLQSMFITELSNGQQTHSLSRVKQDGPVSRSLPRHFKVAGQAPQSAQSYYDINKDKLYV
AKSITLICQAPYAFAAQMFLKNLYRCLPRQPGAGISLESYVYNILYEVMLPQPGKSIRVY
LPPTEPHLPAIAVILQRPLLATELPLLDFPLRLLFKYLGVECVIQLLTCVLLENQVLLRS
TDYQRLMIVGECITSLLFPFVWPHVYAPILPAALHHFLDAPVPFVMGLHAECEAAHKIGS
EATLCFVDIDKKHIQLPEELPVFPHKMDFMAEIGSVLDKFEIDRDRDHEPSFRNGYVGRG
AGGGVGGSGSGGAGGVDAMISSCTLPTGLQAVRRSKERFQQLQETVYTLSGSPGGGVVDY
QPLIAHPSRIDHVPRIADFLRRKGGIRGAGSPVGSPTVSLSSSPVGIYHDVDAVDATMPA
SARRTEKQKLTPVEQYYQDLRINNSVREIFLNRFVHMFHAYEYFVIYPNQARDEWISNRE
TLQNFDKSSFLSDQPEHHRAFLSRFLESQMFATLIDNKILAMWESQPDEQLQLFDQRVKL
LRRRHGENMIAATSYEPCVLSQDSQQGFEKRLNCIDIEVTPPSEILANRAAYFRSFPLLE
KGVLNQECASRGNSLRRVKNGNKWRAREISLDQKPGSNAINRLSANLTTADVSPALIAQA
NWTFVERLLKDIKSKTKRMLLEKMGNEAVALGLKGDGIEENTLIASMCDLLEKIWSHGLQ
NKQGKSALWSHLQAYLEVQDARGAGESSGAEQLPPVSSSPGSKMTIATASPALAWNAMRK
RMDYLSTFQTDFDSPPSPNRSRSRDRNKFVGLEQLCPLPESLEFDVKNVLAMADIKTHIG
YTRAWVRLSLEKKLLSRHFRTLLSDESLLRSLYKRSAFLRCEEEKEQFLYHLLTLNTVDY
FSFTNIYPTTKLPYRVVIFPSRKYGSYHTSSNVWIMVSGTMNETQRVPVPKGSLEFIFHY
KNLGLLTTMRIGHDNSGPSHKWLVEQVVMRNEVTGHTYKFPCGRWLGRGVDDDSTERLLV
GQRVSTSVKNAELVPGADTRTPPRTRSPSVQRQESLAPSEIQHQLGNCVNVLVKWHYKPS
RDRDVGTLTNLLCGDDGLVKCLEQVFLCGFRSARFFGRNLYIWDYFTKVKELFEHNLQME
LEDSASSLDSSFSNGSGSGGNSLQRREISSIWRLYVQLMDEINGTALGKDGKFQLLICLS
LREHLLTRLIKPMALTKVTHEMYEEESFLRRRNLLTFLIQILEPLDDCHIVLENSITQGI
RIPSQC
Download sequence
Identical sequences DS10_00004496 XP_016934356.1.48971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]