SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004554 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004554
Domain Number 1 Region: 1285-1462
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-50
Family DBL homology domain (DH-domain) 0.00000026
Further Details:      
 
Domain Number 2 Region: 1469-1585
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-29
Family Pleckstrin-homology domain (PH domain) 0.0000266
Further Details:      
 
Domain Number 3 Region: 854-996
Classification Level Classification E-value
Superfamily Spectrin repeat 8.38e-22
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 1086-1224
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 5 Region: 299-416
Classification Level Classification E-value
Superfamily Spectrin repeat 5.52e-17
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 520-664
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000275
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 7 Region: 780-894
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000302
Family Spectrin repeat 0.0099
Further Details:      
 
Weak hits

Sequence:  DS10_00004554
Domain Number - Region: 999-1120
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0208
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 152-227
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0288
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 14-107
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.051
Family CRAL/TRIO domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00004554
Sequence length 1815
Sequence
MDGQRARDLLTLLQERVVFLTGGRDRRGGPLLCFPATPRRDRLKPEDLRRLLSYLISIPS
DAAKNLGFTVIIDMRGNGNCSTNVKTILKVLQEHFSANIHNVVIIKPDNFWQKQRASISS
HKYKFETTTVSIESLNKIAESHQLTGDFEGQQLYDHQQWTDARLAIEDFFWQAGDMADRI
DDLQEDLNRNDFAEDVPLARHAIDHHNEMRKKITKLPIEDLDMQGKKLLAKINAMAPPGG
QASSSGGSDMDSGPSSAGQQSQPQQSRSASGNPDMSAAVNKALRQIDLIHTGQEKLLMLW
QHKKVKLDQCFQWRLFEQDCEKMFDWILHNRDVFQMSYVEIGHNYSVAKSLQDEHQKFAV
ASMNVSVNIDRILAVAARLIESQHYAAQHIKTLAQRLDRTWKDFAAGLDERTAVLQLSVL
FHHKAEQYCNSVASWAAACQASQPLPSDIQSLETAIRTHQSLYEAMCQAYTEVHSTSKKL
LYQLDHLVQVCNQPPPPGVPDHRKNSNGGSFNKYERQNPAADYSEGASHVLAVIHQILGH
HRTLEAKWHQERLRLHQTLALRLFQEDVKQVLDWLKNHGEVFLRKNTGIGRNFHKARVYQ
TSHDNFENVAQNTYSNAQKLLAAADELARSGEADPNEIYSVARELELQVGSFAERVEQRR
RRLEMAVIFYTHEKDVTAWIDKLRTDVSTDETRLSQENLEGIERILQQYQRDQQESSVNV
CLTTIAQGEALLQEMRSLEYADNTGSIAALEATLEKLSKQKLELEELWSARKFRADLILR
LRYFERDAMELSSQLEIWSEELQHADLSRDYQKAEQLIRMHNESVTDIQNATYEVLQQGQ
DLLQLFENAGFISMADATHTAQARIEYLLDFLREREIDLEEMSEAKRAKLEQAVQLCQFQ
NDANQVISWIRNGEAMLVASFVTPNSLQEAEQLRKGHEQFQIAIEKTHTSAVQVKYRADA
LINANHYDPQSIREISDDVTKKWQQLVTYAEERHKLVTASINFYKTAEQVCSVLDSLERE
YKREDDWCGGGGGSDKAQTIVQLISKHQEQKEAFLKACTLARRTAETFLKYANRSQQCYQ
YKGNCEAHVKSKLDKLLTQENQVLDYWTLRKKSLDQCQQFVLFERSAKQAIEWIHNTGEA
YLSSRSNLVGISKEETEGLLKEHNEFRSTAKETRERVKLLIQLADSLVEKGHAHASDIKQ
WVASVDQRYKDFSNRMDSYCEQLEKSLGMSQQQLLLGSDGNSSISSSSGVSGGDRHSDPT
LEAKLNSSNKENKEINEEKRKSARRKEFIMAELMQTERAYVNDLATCIKCFLEEFRAGRN
VPPALIGQEDVIFGNIREIHHFHQKIFLRELEKYETMPEDVGHCFVTWASKFDMYVHYCK
NKPTSNNLLVQHGGSFFEELQRRLEVDHPLPAYLIKPVQRITKYQLLLKDLLSCCEESHG
EIKEGLEVMLNVPKKANDAMHLSLLENCDVSIDKLGEVVLQDAFQAWDTKQIIRKGRERR
VFLFELYLLFAKEVKESSVVKYQFKSKLMTTDMGITEHIEGDETKFAVWTGRSPMLSDCR
IVLKATSLETKQIWVKKLREVMQETCFSGTSLTLPKSPAKHSGSSQRSSRDLDEQLTEND
HDRCSLASFGSGNTTDSDNKSVKKFLNERMNSVDSADGVGGGGKKSSLERLKCGEDKDTP
TKGYVSLPNTPLPMSAPIAMGDPSPSPSIADSAQNTPLCTLQEDDSTSPPPAGSGKNGHT
QPEQSPFTFPAVASTSSSDPAPNPAPVQRKSRRKISLPWFRQSSVTGHGVLARQHTIDTP
SSFRFFRQPSSSGLK
Download sequence
Identical sequences DS10_00004554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]