SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004867 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004867
Domain Number 1 Region: 614-679,964-1083
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0056
Further Details:      
 
Domain Number 2 Region: 34-122,178-255
Classification Level Classification E-value
Superfamily RUN domain-like 6.8e-30
Family RUN domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1060-1164
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.96e-21
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DS10_00004867
Sequence length 1208
Sequence
MLDILSFTDCTGHPGHSGHTEYIQDIAQGDGSDYKERLIASVKKEVKQLMEEAVTKKYVH
EESSSVTSLCGAVEACLSQGLRRRALGLFKTSSTTALLHKIAKSCPEAEHISKMVQEIEA
SDPSKRSSSSSDSFQRPPMLKKSSSNSMSTGGSNAVATSSSASASASISVSASNSSMSLA
SMKYLWIRLALYEKRLTKIIEYLVSNASSFYDRDSLVADPDYGSILSSLLVGPCALEFTR
AKTADHYWTDPHADELVQRHRISSVRRSSSTCSRPAIINFKRSLNTSSDEASSGSFKSIA
SASVAKDYVESLHQNAKATLLYGKNNVQVLPKDVADPMPGYLSLHQHIQTLTIKWTPNQL
MNGYTEAEEAEDIDKDAFWAYALNINVDEIVYVHCHQSRGEDSGGTVILVGQDGVQRPPI
HFPEGGHMQQFLSCLETGLLPHGQLDPPLWSQRGIGKMFLWPRSMRRRILPSVMESVDET
PIDYVFRIVSKSRHEEFAATHSILDFVRSTPRRAQLSSCSTTGSSDCSNKSLSIDQFPLE
SPLLLQQQQQQLLQAQSTSIEMVCSTMRRQIISRAFYGWLAYCRHLSTVRTHLSGLVHGR
ITPEMKADEEGLTKERWQLLNVDGVLENATEFYRLVYFGGVQPELRQEVWPYLLGHYAFG
STSEERRKQDETCKHYYETTMSEWLAVDAIVQQREKEKTARAVAKLSSGSNSGNERTVRA
ADLEAGGELDNEVFEDISDISDPGDLEFDEQQQLQQQPVECPVSGNHLSVKPIPRAMKTS
TDSGHVDEGENFNELDEEQDEVEVEVEGSKAKKQLDHKKEPVPSAGSADDQEDQLNPEPS
CSTSTASSYETVGPGGGHQQPTSDTRSVLSPEYLSADDLQLPEDEDAVKPPPPPPPQATA
AVIITKASVDITHWERSSKLGEGDQMSPVEEQAGESVGGGGGVNLDALQQPKSACASPAS
SNGGVYSSELLEQFGLNLHRIEKDVQRCDRNYWYFANENLDKLRNVISTYVWEHLDVGYM
QGMCDLVAPLLVIFDDESLSYSCFCKFMERMIENFPSGGAMDMHFANMRSLIQILDSEMY
DLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLE
TYRDIILSNSMDFTDVIKFFNGKWIILKANFSINGRAPQCPIRAPVGPESGPPAADDHRK
QVECGRAG
Download sequence
Identical sequences DS10_00004867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]