SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004868 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004868
Domain Number 1 Region: 25-424,453-478
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.57e-50
Family Cystathionine synthase-like 0.0014
Further Details:      
 
Domain Number 2 Region: 1372-1435,1737-1856
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.2e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0056
Further Details:      
 
Domain Number 3 Region: 516-646
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 3.53e-31
Family MOSC N-terminal domain-like 0.0026
Further Details:      
 
Domain Number 4 Region: 796-885,943-1018
Classification Level Classification E-value
Superfamily RUN domain-like 3.66e-31
Family RUN domain 0.001
Further Details:      
 
Domain Number 5 Region: 1833-1935
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.97e-22
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 6 Region: 609-756
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.000000115
Family MOSC (MOCO sulphurase C-terminal) domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00004868
Sequence length 1996
Sequence
MSLYRSEFSPSEQSTIDAEFSRLAKNKSVYLDHAGTTLYAENQVKAAAEQLQRNVICNPH
TCLITGDFVDQVRFKVLEFFNTTAEDYHVIFTANATAALSLVADNFDFGSSGDFHFCQEN
HTSVLGMRERVQANGIYMLKEDEISGELAKQNGKMVQEGSRKTGNSLVTFSAQCNFSGYK
IPLDAIRKIQNDGLAKAGKQIWGSVDEKKDNTHNDYYICLDAASFVATSPLDLQKYHPDY
VCLSFYKIFGYPTGVGALLVSRRGAEAFGKRRFFGGGTINFAYPHAMDHQLRETFHQRYE
DGTLPFLSIVGLLEGFRTLKRLVPKTGEFGTMERISRHVFGLAKYLEDQLKQLKHPNGEP
LIRLYNKVGYLDKSRQGGIVAFNVLTESGSYVGFGEMACVAALHGILLRTGCFCNIGACQ
YYLGLDEDAMDAIYKRAGRICGDYFDLIDGKPTGAVRVSFGYMTTIQDVEELLKMLRSSY
LATKLEQRIQFIEEQAEQLPPLLKQRVQLLRPKLLQMAIYPVKSCAAFKIESPGSWPLTD
QGLKYDREWMIVDMNGMALTQKRCTELCLIRPVIRADQLELQFGPDSSVSVPLSLEDQAA
DSAKCVSKVCRQPVEGLDCGDEVAQWLSQNLGLEGIRLLRQSGQRNSSKDRQKLSLVNQA
QFLLLNKSSVRSLQFEEPLDETVDRFRANIIIDTGCAFEELAYKALTIGGLRFQVEGPCQ
RCDMICINQRTGERSPETLTTISRLQQGRMRFGIYITRISKDQPDLEVKEQHMTCGDIVL
VRIQGSFLASSQAETELKERLIASVKKEVKQLMEEAVTKKYVHEESSSVTSLCGAVEACL
SHGLRRRALGLFKTSSTTALIQKIAKICPEADYVSRRLLELELAQESHAVSGKRSSSSSD
SIIKPKLLSKSSGSSNSVTTINTVSNGAATGTGGGGGGGGSIAPLGKYLWIRLALHEKRL
AKIIEHLVSNASSYYDREALVADPDYGSILSSLLVGPCALEFTRAKTADHYWSDPCADEL
VQRHRISSGNRTPPTTHRPIINFKRSLHTSSEDTSSGSFKACSPASVAKDYVESLHQNSR
TTLLYGKNNVLVLPKDVSEPMPGYLSLHQSIQSLTIKWTPNQLMNGYNDGDGGDKSFYWG
YALNINVDEIVYVHCHQNRGGDTGGTIILVGQDGVQRPPIHFPEGGHLQAFLSCLETGLL
PHGQLDPPLWSQRGIGKLFPWPKSVRRHILPSVMEAGAPAADETPIDYVFRVVSKCQHEE
FLASHPILELGRSSPRRKHLGSCSTTGSSDCSSKSLSIDQSSCETPLIQASQSTSIELVC
STMRRQIISRAFYGWLAYCRHLSTVRTHLSGLVNVRIMPDLAADEEGLTRDKWLAMHEDG
VVTGDLELYRLVYFGGVEPDLRKDVWPYLLGHYAFGSTPEERQKQDETCKHYYETTMSEW
LAVEAIVRQREKEKTALAVAKLSAEQARLAANASGSLNPHQKLTNGSRQLELEQRNDEEE
QERIILDEGENDVFDDNDFSDISDPGDLFDEPELGQEAEEQEGQSSPGEELLARQEDQQE
ERGMPRLSEQLVLEFQNLDNMEPLRLQENCFADSENENDLGLGLDGSGNILMLSIKSSPS
TSSYETVGNEFVDMAEAKLDEEERPGELSKFHSADDVRLDNPVEEEEEPSQPATAVIITE
AASLDALDVDDDPTEEFTSRKTSLMSPLNEDITVVASLDALQEPKSACVSPASSNGGVYS
VELLEQFGLNLHRIEKDVQRCDRNYWYFANENLDKLRNVISTYVWEHLDVGYMQGMCDLV
APLLVIFDDESLSYSCFCKLMERMIENFPSGGAMDMHFANMRSLIQILDSEMYDLMDSNG
DYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLETYRDIIL
SNSMDFTDVIKFFNGKNGRAPQRPVDPAAVQKPGPPVTDHHREQVKSHRHTSDISHPSTV
PGDLSSRSVLSIRCTK
Download sequence
Identical sequences DS10_00004868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]