SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004921 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004921
Domain Number 1 Region: 271-560
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.85e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000228
Further Details:      
 
Domain Number 2 Region: 5-93
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.46e-17
Family CRAL/TRIO domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00004921
Sequence length 580
Sequence
MSNATNWFSGGYPARLKKVLIVTAPLWFKAPFKILRLFVREKLRERVFTVSVPQLALHVP
RKALPIHLGGTLEVDHATWLLSCRQSMTNREDELLANIVGVAGSGSATGSAAVATNGTES
AEAATTGATIISAVHLLGDNNTTVVTVSNGVGPAGGAASAAASAVSCSSESNENITINGL
SPSHRQASNSSSSGSSNATAANPLKLNTSGSAENNSTTAAATVAGAAGATGGTTTTNGGG
EFWSENPPSSASSGFSDDDSLAGQEGDPKPIDQIVQMVKQRGRHGLIKEYADIRNRAPEG
TFLHARMRANLTKNRYTDVLCYDHSRVVLAHEDGDEPSDYINANFVDGYKQKNAYISTQG
PLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRVKCGQYWEPTEESSLEFGDYHVRTISVE
CNEDYMVASLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAELVNA
LGDTWAGHARGPPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYS
IQMPDQYVFCHLALIEYAYSRGMLQTVDLAGFDEREQDSE
Download sequence
Identical sequences DS10_00004921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]