SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004984 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004984
Domain Number 1 Region: 796-1028
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.27e-62
Family Carbonic anhydrase 0.0000223
Further Details:      
 
Domain Number 2 Region: 145-202
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000017
Family RUN domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00004984
Sequence length 1044
Sequence
MATPPPPHPFATGAAESAVDAAAEDATAEDATAEHPQQKQRLQQQQQLARNSLLADLRRS
TNFWFRAAKSKDSLQLLAQSCTRILQHGLLQPVELQRLSDDFEFLLASAGKQQQQSQARP
PPYRPDCARGSASSAVAGVEEFLGEWTIRCLRARCLSQCLQTLVSDPELMELYYPSEEAF
LRRSSDATALFVCLTAVQLNQSGLLGQLEVRHQLRHRRTCSQPNFSISPKLQVVPEERLQ
KRSFLRRLKSLPNLTQEDEELDDRTSFRRRCQTFSSSRSAKPREDHLDAPSTSSCSSSDS
PKRIQLINCDDIKIWTDQTPQEVAPEVHEKKMQEAPKVSSSVGSYLGSFFGSTPLYTSWF
QRGVGEDLNASGDGGMLDTFLPVNGRKLKKHQTLFEGVSMLDEAAATTTGGTSAPWDIQG
SAGGGSTTSTTASSSVSITPGSDKIDQQSLASFLQMSRQTHNNTQLEKENAHFRISEACI
TAIEHVKWSRRFARPAGPANTNPSEPNLMPYVEQIPGDVQSNSAEAVGLQLISRFSEQQL
PRLGHLKWLVSEQEAPQQLLPLPIPKHEDHEQASLTRGTASWAPPRQQIIFTEHPSENRT
KVLQRQNNRCTGCGMRVAKHLQQHFRYCTYLGKYLCTGCHRNQISAIPARILRSWDFRCY
PVCSFAYRLIEQMYAFPLFHVPDLNGQLYKHKELARARRKRLQLRAVKGFIANCRFATRE
QAFFTAIPAHLTQDPDMWSMCDFVDVQNTSMNRSIKEVIALSEQHVHNCVLCTGRAFLCE
HCKGDPEGISSQRAMPVQSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMV
TFSKRKQQPYIIGGALDTDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNAKY
KDFAEAKNKPDGLAVVAFFIQACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGL
QELSKHYYTYKGSLTTAPYFESVTWIIYRTPIYVSRGQVQVFRNLQSCPKDESKKIVNNY
REIQRPHKDPEIFFARNTNPKSKL
Download sequence
Identical sequences DS10_00004984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]