SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00007396 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00007396
Domain Number 1 Region: 84-264
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.88e-36
Family CRAL/TRIO domain 0.0016
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000157
Family CRAL/TRIO N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00007396
Sequence length 298
Sequence
MKEADLENQYARFPEIQRSEVLKFLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQV
LDTNLTARTHLVEFFENLDCERPEIRRAMRTVSIVPLPGSTPEGYRVILAKLDDLNTSNY
NFADVMKLYCMIFDFWMYEDGIQPGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAA
IRLIGFHFINIVPFMDKILALMTPFMKKELTTVLHVHSDMKEFYKFVPKEMLPNEYGGQV
EETNIAKEIYYKKLLDNRKEMLEFETRHQVNEKCRPGKPKNASDLFGIEGNFKKLDID
Download sequence
Identical sequences XP_016931285.1.48971 DS10_00007396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]